SIM1 Antibody

Images

 
Western Blot: SIM1 Antibody [NBP2-84261] - WB Suggested Anti-SIM1 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:312500. Positive Control: Human Stomach
Immunohistochemistry: SIM1 Antibody [NBP2-84261] - Pancreas

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SIM1 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human SIM1. Peptide sequence: MKEKSKNAARTRREKENSEFYELAKLLPLPSAITSQLDKASIIRLTTSYL The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
SIM1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SIM1 Antibody

  • BHLHE14
  • bHLHe14single-minded homolog 1
  • Class E basic helix-loop-helix protein 14
  • single-minded (Drosophila) homolog 1
  • single-minded homolog 1 (Drosophila)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-88619
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-124
Species: Bv, Ma, Hu, Mu, Pm, Rt, Sh
Applications: CHIP-SEQ, ChIP, GS, IB, ICC/IF, IHC, IHC-P, IP, WB
NB100-1533
Species: Hu, Mu, Po, Rt, Sh
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
NBP2-41103
Species: Hu, Mu, Rt
Applications: ELISA, IF, IHC, IHC-P, WB
NBP1-88623
Species: Hu
Applications: ICC/IF
NBP2-80261
Applications: ELISA
NBP3-15136
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P
NBP2-21585
Species: Pm, Hu, Mu, Rt
Applications: ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NBP2-94348
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
AF009
Species: Hu
Applications: IHC, WB
DLP00
Species: Hu
Applications: ELISA
1845-SH/CF
Species: Hu
Applications: BA
NBP2-37447
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, IF, IHC, IHC-P, WB
NB100-2289
Species: Gp, Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, IP, KD, Simple Western, WB
H00001392-M02
Species: Hu
Applications: ELISA, IHC, IHC-P, S-ELISA, WB
NBP2-68928
Species: Hu
Applications: IHC, IHC-P
H00002019-M04
Species: Hu, Mu
Applications: ELISA, IHC, IHC-P, IP, WB
NB100-105
Species: Bv, Ca, Fe, Ma, Hu, Pm, Mu, Po, Pm, Rb, Rt, Sh, Xp
Applications: ChIP, ELISA, Flow, GS, IA, IB, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, IP, In vitro, KD, KO, LA, PLA, Simple Western, TCS, WB

Publications for SIM1 Antibody (NBP2-84261) (0)

There are no publications for SIM1 Antibody (NBP2-84261).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SIM1 Antibody (NBP2-84261) (0)

There are no reviews for SIM1 Antibody (NBP2-84261). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SIM1 Antibody (NBP2-84261) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SIM1 Products

Array NBP2-84261

Bioinformatics Tool for SIM1 Antibody (NBP2-84261)

Discover related pathways, diseases and genes to SIM1 Antibody (NBP2-84261). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SIM1 Antibody (NBP2-84261)

Discover more about diseases related to SIM1 Antibody (NBP2-84261).
 

Pathways for SIM1 Antibody (NBP2-84261)

View related products by pathway.

PTMs for SIM1 Antibody (NBP2-84261)

Learn more about PTMs related to SIM1 Antibody (NBP2-84261).
 

Research Areas for SIM1 Antibody (NBP2-84261)

Find related products by research area.

Blogs on SIM1

There are no specific blogs for SIM1, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SIM1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SIM1