ARID5A Antibody - BSA Free

Western Blot: ARID5A Antibody [NBP1-79452] - COLO205 cells lysate, concentration 0.2-1 ug/ml.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

ARID5A Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptide directed towards the N terminal of human ARID5AThe immunogen for this antibody is ARID5A (NP_997646). Peptide sequence MAAPVKGNRKQSTEGDALDPPASPKPAGKQNGIQNPISLEDSPEAGGERE. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ARID5A
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 64 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for ARID5A Antibody - BSA Free

• ARID domain-containing protein 5A
• AT rich interactive domain 5A (MRF1-like)
• AT-rich interactive domain-containing protein 5A
• RFVG5814

Background

Members of the ARID protein family, including ARID5A, have diverse functions but all appear to play important roles indevelopment, tissue-specific gene expression, and regulation of cell growth (Patsialou et al., 2005 (PubMed15640446)).(supplied by OMIM)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

FAQs for ARID5A Antibody (NBP1-79452). (Showing 1 - 2 of 2 FAQ).

1. What is better for blocking? Non fat milk? TBS-T?
   • TBS-T is better for blocking.
2. What is the size of ARID5A?
   • The theoretical molecular weight for ARID5A is 64 kDa.

Bioinformatics

• Gene Symbol: ARID5A
• Entrez:
  • 10865(Human)
• Uniprot:
  • Q03989(Human)