ARID5A Antibody


Western Blot: ARID5A Antibody [NBP1-79441] - Sample Tissue: Human 721_B Antibody Dilution: 1.0 ug/ml
Immunohistochemistry: ARID5A Antibody [NBP1-79441] - Human Prostate lysate tissue at an antibody concentration of 5.0 ug/ml using anti-ARID5A antibody
Western Blot: ARID5A Antibody [NBP1-79441] - 721_B cell lysate, Antibody Titration: 0.2-1 ug/ml

Product Details

Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P

Order Details

ARID5A Antibody Summary

Synthetic peptide directed towards the C terminal of human ARID5AThe immunogen for this antibody is ARID5A. Peptide sequence MAAGLMHFPPTSFDSALRHRLCPASSAWHAPPVTTYAAPHFFHLNTKL.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:1000
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 5 ug/ml
Application Notes
This is a rabbit polyclonal antibody against ARID5A and was validated on Western blot.
Theoretical MW
64 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for ARID5A Antibody

  • ARID domain-containing protein 5A
  • AT rich interactive domain 5A (MRF1-like)
  • AT-rich interactive domain-containing protein 5A
  • RFVG5814


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt, Po
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, PEP-ELISA, ICC
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ChIP, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: WB, Simple Western, IHC
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Mu
Applications: WB, Simple Western, ICC
Species: Hu, Mu, Rt, Ch, Rb
Applications: WB, ICC/IF
Species: Hu
Applications: WB, ELISA
Species: Hu
Applications: WB, ICC
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Rt, Am, Dr
Applications: WB, EM, ELISA, ICC/IF, IP
Species: Hu, Mu, Rt, Av, Ch, GP, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IHC-WhMt
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Po, Bv, Ch, GP, Ma, Rb, Sh
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, RI
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P

Publications for ARID5A Antibody (NBP1-79441) (0)

There are no publications for ARID5A Antibody (NBP1-79441).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ARID5A Antibody (NBP1-79441) (0)

There are no reviews for ARID5A Antibody (NBP1-79441). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ARID5A Antibody (NBP1-79441) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Array Products

Bioinformatics Tool for ARID5A Antibody (NBP1-79441)

Discover related pathways, diseases and genes to ARID5A Antibody (NBP1-79441). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ARID5A Antibody (NBP1-79441)

Discover more about diseases related to ARID5A Antibody (NBP1-79441).

Pathways for ARID5A Antibody (NBP1-79441)

View related products by pathway.

PTMs for ARID5A Antibody (NBP1-79441)

Learn more about PTMs related to ARID5A Antibody (NBP1-79441).

Blogs on ARID5A

There are no specific blogs for ARID5A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our ARID5A Antibody and receive a gift card or discount.


Gene Symbol ARID5A