ARID1B Antibody (2F2)

Images

 
Western Blot: ARID1B Antibody (2F2) [H00057492-M02] - ARID1B monoclonal antibody (M02), clone 2F2 Analysis of ARID1B expression in Hela S3 NE.
Immunocytochemistry/ Immunofluorescence: ARID1B Antibody (2F2) [H00057492-M02] - Analysis of monoclonal antibody to ARID1B on HeLa cell. Antibody concentration 10 ug/ml.
Immunohistochemistry-Paraffin: ARID1B Antibody (2F2) [H00057492-M02] - Analysis of monoclonal antibody to ARID1B on formalin-fixed paraffin-embedded human placenta. Antibody concentration 3 ug/ml.
Immunohistochemistry-Paraffin: ARID1B Antibody (2F2) [H00057492-M02] - IHC analysis of ARID1B in human pancreatic cancer tissue samples. Image courtesy of anonymous customer product review.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA
Clone
2F2
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

ARID1B Antibody (2F2) Summary

Immunogen
ARID1B (NP_059989, 1364 a.a. ~ 1460 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. PPAKRHEGDMYNMQYSSQQQEMYNQYGGSYSGPDRRPIQGQYPYPYSRERMQGPGQIQTHGIPPQMMGGPLQSSSSEGPQQNMWAARNDMPYPYQNR
Specificity
ARID1B (2F2)
Isotype
IgG2b Kappa
Clonality
Monoclonal
Host
Mouse
Gene
ARID1B
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500
  • ELISA 1:100-1:2000
  • Immunocytochemistry/Immunofluorescence 1:10-1:500
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
  • Sandwich ELISA
Application Notes
Antibody reactive against recominant protein and cell lysate for Western Blot. Has also been used for immunofluoresence, immunohistochemistry (paraffin), and ELISA.
Reviewed Applications
Read 1 Review rated 5
using
H00057492-M02 in the following applications:

Publications
Read Publications using
H00057492-M02 in the following applications:

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for ARID1B Antibody (2F2)

  • 6A3-5
  • ARID domain-containing protein 1B
  • AT rich interactive domain 1B (SWI1-like)
  • BAF250B
  • BRG1-associated factor 250b
  • BRG1-binding protein ELD/OSA1
  • BRG1-binding protein hELD/OSA1
  • BRIGHT
  • DAN15P250R
  • ELD (eyelid)/OSA protein
  • ELD/OSA1
  • hOsa2
  • JPUT1
  • KDM5B
  • KIAA1235AT-rich interactive domain-containing protein 1B
  • Osa homolog 2
  • OSA2
  • p250R
  • PLU1
  • RBBP2H1A

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-88932
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP2-66840
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-61879
Species: Hu, Mu
Applications: WB, ELISA, Flow, IHC, IHC-P
NB100-2594
Species: Hu, Mu
Applications: WB, ChIP, IHC, IHC-P, IP
NBP1-90015
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-37364
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready, Flow-IC, KD
NBP2-00932
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
H00008815-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA
NB100-79833
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-57220
Species: Hu
Applications: ICC/IF
NB100-93337
Species: Hu, Mu
Applications: WB, IP
NBP2-76825
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, IP
H00006598-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA
NBP2-20415
Species: Hu, Mu, Rt
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP
NBP1-30941
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-2242
Species: Hu, Mu
Applications: WB, ChIP, IP
NBP2-95239
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-28727
Species: Hu
Applications: IP (-), WB, IHC, IHC-P, IP

Publications for ARID1B Antibody (H00057492-M02)(4)

Review for ARID1B Antibody (H00057492-M02) (1) 51

Average Rating: 5
(Based on 1 review)
We have 1 review tested in 1 species: Human.

Reviews using H00057492-M02:
Filter by Applications
IHC
(1)
All Applications
Filter by Species
Human
(1)
All Species
Images Ratings Applications Species Date Details
Immunohistochemistry ARID1B H00057492-M02
Enlarge
reviewed by:
Murali Bashyam
IHC Human 11/15/2012
View

Summary

ApplicationImmunohistochemistry
Sample TestedPancreatic cancer samples
SpeciesHuman
CommentsARID1B antibody exhibits excellent specificity in IHC without any non-specific background. Results are comparable between manual and Ventana autostainer instrument

Blocking

Blocking Details2.5% normal serum for 30 mins

Primary Anitbody

Dilution RatioARID1B antibody – 1:500 dilution (Dako diluent) for 1 hr at room temperature

Secondary Antibody

Secondary DescriptionHRP mouse/rabbit Ready to use (peroxidase-conjugated polymer)
Secondary ConcentrationIncubation - 30 mins at room temperature

Details

Detection NotesDAB based detection system, incubation time 5-10 mins
Fixation Details10X buffered formalin for 24 hrs, Citrate buffer at pH 6.0 for 10 min using pressure cooker, 3% Hydrogen Peroxide: add 10 ml 30%
Wash Description1X TBS, Wash sections in TBS two times for 5 minutes each

Comments

CommentsARID1B antibody exhibits excellent specificity in IHC without any non-specific background. Results are comparable between manual and Ventana autostainer instrument

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for ARID1B Antibody (H00057492-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional ARID1B Products

Array H00057492-M02

Bioinformatics Tool for ARID1B Antibody (H00057492-M02)

Discover related pathways, diseases and genes to ARID1B Antibody (H00057492-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ARID1B Antibody (H00057492-M02)

Discover more about diseases related to ARID1B Antibody (H00057492-M02).
 

Pathways for ARID1B Antibody (H00057492-M02)

View related products by pathway.

PTMs for ARID1B Antibody (H00057492-M02)

Learn more about PTMs related to ARID1B Antibody (H00057492-M02).

Blogs on ARID1B

There are no specific blogs for ARID1B, but you can read our latest blog posts.
Coronavirus Brochure

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

5
5
1
4
0
3
0
2
0
1
0

Murali Bashyam
11/15/2012
Application: IHC
Species: Human

Bioinformatics

Gene Symbol ARID1B
Entrez
Uniprot