Novus Biologicals products are now on bio-techne.com

ARHGEF4 Antibody

Images

 
Immunohistochemistry-Paraffin: ARHGEF4 Antibody [NBP1-88857] - Staining of human cerebral cortex shows cytoplasmic positivity in neurons.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ARHGEF4 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: VLYYKGRLDMDGLEVVDLEDGKDRDLHVSIKNAFRLHRGATGDSHLLCTRKPEQKQRWLKAFAREREQVQLDQETG
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ARHGEF4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
ARHGEF4 Protein (NBP1-88857PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (89%), Rat (89%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ARHGEF4 Antibody

  • APC-stimulated guanine nucleotide exchange factor 1
  • Asef
  • ASEF1
  • ASEFAPC-stimulated guanine nucleotide exchange factor
  • GEF4
  • KIAA1112
  • Rho guanine nucleotide exchange factor (GEF) 4
  • rho guanine nucleotide exchange factor 4
  • STM6

Background

Rho GTPases play a fundamental role in numerous cellular processes that are initiated by extracellular stimuli that work through Gucleotide exchange protein coupled receptors. Acts as guanine nucleotide exchange factor (GEF) for RhoA and RAC1 GTPases. Binding of APC may activate RAC1 GEF activity. The APC-ARHGEF4 complex seems to be involved in cell migration as well as in E-cadherin-mediated cell-cell adhesion. This protein is similar to rat collybistin protein. Alternative splicing of the gene generates two transcript variants which encode different isoforms.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-91662
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NB110-68800
Species: Hu, Mu
Applications: ICC/IF, WB
NBP2-21577
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, WB
H00056731-M02
Species: Hu
Applications: ELISA, ICC/IF, WB
AF6260
Species: Hu
Applications: WB
NBP2-67895
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, IP, WB
NBP1-85727
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-86509
Species: Hu
Applications: IHC, IHC-P
AF1329
Species: Hu, Mu, Rt
Applications: ChIP, CyTOF-ready, ICC, IHC, ICFlow, Simple Western, WB
NBP1-30981
Species: Hu, Mu
Applications: ICC/IF, WB
AF2685
Species: Hu
Applications: IHC, Simple Western, WB
NB100-91266
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
NB100-1343
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
294-HG
Species: Hu
Applications: BA
NBP2-48615
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-31234
Species: Hu
Applications: ICC/IF, IHC, IHC-P, IP, WB
233-FB
Species: Hu
Applications: BA
NB100-91273
Species: Hu, Mu, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, WB

Publications for ARHGEF4 Antibody (NBP1-88857) (0)

There are no publications for ARHGEF4 Antibody (NBP1-88857).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ARHGEF4 Antibody (NBP1-88857) (0)

There are no reviews for ARHGEF4 Antibody (NBP1-88857). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for ARHGEF4 Antibody (NBP1-88857) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ARHGEF4 Products

Research Areas for ARHGEF4 Antibody (NBP1-88857)

Find related products by research area.

Blogs on ARHGEF4

There are no specific blogs for ARHGEF4, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ARHGEF4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ARHGEF4