ARHGEF4 Antibody - BSA Free

Immunohistochemistry-Paraffin: ARHGEF4 Antibody [NBP1-88857] - Staining of human cerebral cortex shows cytoplasmic positivity in neurons.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

ARHGEF4 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit ARHGEF4 Antibody - BSA Free (NBP1-88857) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: VLYYKGRLDMDGLEVVDLEDGKDRDLHVSIKNAFRLHRGATGDSHLLCTRKPEQKQRWLKAFAREREQVQLDQETG
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ARHGEF4
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  ARHGEF4 Protein (NBP1-88857PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (89%), Rat (89%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for ARHGEF4 Antibody - BSA Free

• APC-stimulated guanine nucleotide exchange factor 1
• Asef
• ASEF1
• ASEFAPC-stimulated guanine nucleotide exchange factor
• GEF4
• KIAA1112
• Rho guanine nucleotide exchange factor (GEF) 4
• rho guanine nucleotide exchange factor 4
• STM6

Background

Rho GTPases play a fundamental role in numerous cellular processes that are initiated by extracellular stimuli that work through Gucleotide exchange protein coupled receptors. Acts as guanine nucleotide exchange factor (GEF) for RhoA and RAC1 GTPases. Binding of APC may activate RAC1 GEF activity. The APC-ARHGEF4 complex seems to be involved in cell migration as well as in E-cadherin-mediated cell-cell adhesion. This protein is similar to rat collybistin protein. Alternative splicing of the gene generates two transcript variants which encode different isoforms.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ARHGEF4