ARHGEF4 Antibody

Images

 
Immunohistochemistry-Paraffin: ARHGEF4 Antibody [NBP1-88857] - Staining of human cerebral cortex shows cytoplasmic positivity in neurons.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ARHGEF4 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:VLYYKGRLDMDGLEVVDLEDGKDRDLHVSIKNAFRLHRGATGDSHLLCTRKPEQKQRWLKAFAREREQVQLDQETG
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ARHGEF4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
ARHGEF4 Protein (NBP1-88857PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (89%), Rat (89%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ARHGEF4 Antibody

  • APC-stimulated guanine nucleotide exchange factor 1
  • Asef
  • ASEF1
  • ASEFAPC-stimulated guanine nucleotide exchange factor
  • GEF4
  • KIAA1112
  • Rho guanine nucleotide exchange factor (GEF) 4
  • rho guanine nucleotide exchange factor 4
  • STM6

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-91662
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-52556
Species: Hu, Mu, Po, Bt, Bv, Ca, Mk, Pm, Rb
Applications: IHC-P
NBP2-21577
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
H00056731-M02
Species: Hu
Applications: WB, ELISA, ICC/IF
AF6260
Species: Hu
Applications: WB
NBP2-14907
Species: Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-85727
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF4885
Species: Mu
Applications: WB, IP
NBP1-54467
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
NBP1-30981
Species: Hu, Mu
Applications: WB, ICC/IF
AF2685
Species: Hu
Applications: WB, Simple Western, IHC
NB100-91266
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, ICC
NBP2-02300
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP1-52084
Species: Hu, Mu, Rt
Applications: WB, IHC-P, PEP-ELISA
NBP1-83385
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-91273
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88857
Species: Hu
Applications: IHC, IHC-P

Publications for ARHGEF4 Antibody (NBP1-88857) (0)

There are no publications for ARHGEF4 Antibody (NBP1-88857).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ARHGEF4 Antibody (NBP1-88857) (0)

There are no reviews for ARHGEF4 Antibody (NBP1-88857). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for ARHGEF4 Antibody (NBP1-88857) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ARHGEF4 Products

Bioinformatics Tool for ARHGEF4 Antibody (NBP1-88857)

Discover related pathways, diseases and genes to ARHGEF4 Antibody (NBP1-88857). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ARHGEF4 Antibody (NBP1-88857)

Discover more about diseases related to ARHGEF4 Antibody (NBP1-88857).

Research Areas for ARHGEF4 Antibody (NBP1-88857)

Find related products by research area.

Blogs on ARHGEF4

There are no specific blogs for ARHGEF4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ARHGEF4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ARHGEF4