ARHGAP4 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: ARHGAP4 Antibody [NBP1-88528] - Staining of human cell line U-2 OS shows positivity in cytoplasm, focal adhesion sites and nucleus but excluded from the nucleoli.

Analysis in human spleen and skeletal muscle tissues using HPA001083 antibody. Corresponding ARHGAP4 RNA-seq data are presented for the same tissues.

Staining of human spleen shows strong cytoplasmic positivity in cells in red and white pulp.

Staining of human skeletal muscle shows very weak cytoplasmic positivity in myocytes.

Staining of human cerebral cortex, liver, lymphoid tissues and skeletal muscle using Anti-ARHGAP4 antibody NBP1-88528 (A) shows similar protein distribution across tissues to independent antibody NBP1-88527 (B).

Immunohistochemistry-Paraffin: ARHGAP4 Antibody [NBP1-88528] - Staining of human cerebral cortex shows low expression as expected.

Immunohistochemistry-Paraffin: ARHGAP4 Antibody [NBP1-88528] - Staining of human spleen shows high expression.

Staining of human cerebral cortex shows very weak cytoplasmic positivity in neuronal cells.

Staining of human tonsil shows strong cytoplasmic positivity in germinal and non germinal center cells.

Staining of human liver shows very weak cytoplasmic positivity in hepatocytes.

• Reactivity: Hu
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

ARHGAP4 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit ARHGAP4 Antibody - BSA Free (NBP1-88528) is a polyclonal antibody validated for use in IHC and ICC/IF. Anti-ARHGAP4 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: DRQTIETEEVNKTLKATLQALLEVVASDDGDVLDSFQTSPSTESLKSTSSDPGSRQAGRRRGQQQETETFYLTKLQEYLSGRSILAKLQAKHEKLQEALQRGDKEEQEVSWTQYT
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ARHGAP4
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  ARHGAP4 Protein (NBP1-88528PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (83%), Rat (88%). Reactivity reported in scientific literature (PMID: 23435261)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for ARHGAP4 Antibody - BSA Free

• RGC1
• Rho GTPase activating protein 4

Background

The ARHGAP4 gene encodes a member of the rhoGAP family of proteins which play a role in the regulation of small GTP-bindingproteins belonging to the RAS superfamily. The protein encoded by the orthologous gene in rat is localized to theGolgi complex and can redi

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for ARHGAP4 Antibody (NBP1-88528)(1)

Publication using NBP1-88528

• Stadler C, Rexhepaj E, Singan VR et al. Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells. Nat Methods 2013-04-01 [PMID: 23435261]

Bioinformatics

• Gene Symbol: ARHGAP4
• Entrez:
  • 393(Human)
• Uniprot:
  • P98171(Human)