Home » ARFGEF2 » ARFGEF2 Antibodies » ARFGEF2 Antibody

ARFGEF2 Antibody

 (1 Publication)
 See All Related
Submit a Review

Images

 
(
Enlarge)
Western Blot: ARFGEF2 Antibody [NBP1-88607] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10. Lane 2: CACO-2
Western Blot: ARFGEF2 Antibody [NBP1-88607] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10. Lane 2: CACO-2
Immunohistochemistry-Paraffin: ARFGEF2 Antibody [NBP1-88607] - Staining of human small intestine shows distinct cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

ARFGEF2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: KPIQSKPQSPVIQAAAVSPKFVRLKHSQAQSKPTTPEKTDLTNGEHARSDSGKVSTENGDAPRERGSSLSGTDDGAQEVVKDILEDVVTSAIKAAEKHGLTEPERVLGELECQECAIPPGVDENSQTNGI
Specificity
Specificity of human ARFGEF2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ARFGEF2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Publications
Read Publication using NBP1-88607.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 22291037)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ARFGEF2 Antibody

  • ADP-ribosylation factor guanine nucleotide-exchange factor 2 (brefeldinA-inhibited)
  • ARFGEP2
  • BIG2brefeldin A-inhibited guanine nucleotide-exchange protein 2
  • Brefeldin A-inhibited GEP 2
  • dJ1164I10.1
  • FLJ23723
  • PVNH2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

ARFGEF1 Antibody
NBP1-88840
Western Blot: ARFGEF1 Antibody [NBP1-88840] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10Lane 2: Human cell line RT-4
Immunocytochemistry/Immunofluorescence: ARFGEF1 Antibody [NBP1-88840] - Staining of mouse piriform cortex shows neuronal staining in various layers.
Immunohistochemistry-Paraffin: ARFGEF1 Antibody [NBP1-88840] - Staining of human cerebral cortex shows strong positivity in subsets of neurons.
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
p16INK4a/CDKN2A
Antibody
NB200-106
Western Blot: p16INK4a/CDKN2A Antibody [NB200-106] - Analysis of p16INK4a/CDKN2A in (A) NIH/3T3 and (B) MEF cells.
Immunocytochemistry/Immunofluorescence: p16INK4a/CDKN2A Antibody [NB200-106] - Adult mouse kidney (glomerulus). Image from verified customer review.
Immunohistochemistry-Paraffin: p16INK4a/CDKN2A Antibody [NB200-106] - Analysis of FFPE mouse spleen using p16INK4a/CDKN2A antibody at 10 ug/mL on a Bond Rx autostainer (Leica Biosystems). The assay involved 20 minutes of heat induced antigen retrieval (HIER) using 10mM sodium citrate buffer (pH 6.0) and endogenous peroxidase quenching with peroxide block. The sections were incubated with primary antibody for 30 minutes and Bond Polymer Refine Detection (Leica Biosystems) with DAB was used for signal development followed by counterstaining with hematoxylin. Whole slide scanning and capturing of representative images was performed using Aperio AT2 (Leica Biosystems). Nuclear staining in the germinal centers of spleen was observed. Staining was performed by Histowiz.
(1 Review)
(41 Publications)
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
ARF1 Antibody (1D9)
NB300-505
Western Blot: ARF1 Antibody (1D9) [NB300-505] - Analysis of canine heart extract.
Immunocytochemistry/Immunofluorescence: ARF1 Antibody (1D9) [NB300-505] - Analysis of ADP-Ribosylation Factor (green), F-Actin staining with Phalloidin (red) and nuclei with DAPI (blue) is shown.
Immunohistochemistry-Paraffin: ARF1 Antibody (1D9) [NB300-505] - Both normal and cancer biopsies of deparaffinized Human colon carcinoma tissues.
(11 Publications)
Species: Hu, Mu, Rt, Bv, Ca
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP
GBF1 Antibody
NBP2-16619
Western Blot: GBF1 Antibody [NBP2-16619] - Sample (30 ug of whole cell lysate) A: Hela 5% SDS PAGE gel, diluted at 1:1000.
Immunocytochemistry/Immunofluorescence: GBF1 Antibody [NBP2-16619] - Immunofluorescence analysis of methanol-fixed HeLa, using antibody at 1:200 dilution.
Immunohistochemistry-Paraffin: GBF1 Antibody [NBP2-16619] - Human colon carcinoma analysis. Sample: Paraffin-embedded colon carcinoma dilution: 1:500.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Prostaglandin E
Synthase 2/PTGES2 Ant ...
NBP2-45904
Western Blot: Prostaglandin E Synthase 2/PTGES2 Antibody (2C3) [NBP2-45904] - Analysis of HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY PTGES2.
Immunohistochemistry: Prostaglandin E Synthase 2/PTGES2 Antibody (2C3) [NBP2-45904] - Analysis of Human pancreas tissue.
Immunohistochemistry: Prostaglandin E Synthase 2/PTGES2 Antibody (2C3) [NBP2-45904] - Analysis of Human Kidney tissue.
Species: Hu
Applications: WB, IHC, IF
Thyroglobulin
Antibody (2H11 + 6E1)
NBP2-34294
Immunohistochemistry-Paraffin: Thyroglobulin Antibody (2H11+6E1) [NBP2-34294] - Thyroglobulin staining in thyroid tissue of normal C57 mouse (Red). Dilution is 1:100. This image was submitted via customer Review.
Immunohistochemistry-Paraffin: Thyroglobulin Antibody (2H11+6E1) [NBP2-34294] - Analysis using Azide/BSA FREE version of NBP2-34294. Human Thyroid stained with Thyroglobulin Ab (2H11 + 6E1).
Immunohistochemistry: Thyroglobulin Antibody (2H11+6E1) [NBP2-34294] - Imaging of Mouse stomach tissue. Positive staining can only be observed inside the thyroid cells and the follicle in thyroid tissue. This image was submitted via customer Review.
(2 Reviews)
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P
ARF3 Antibody
NBP1-31004
Western Blot: ARF3 Antibody [NBP1-31004] - Sample (30 ug of whole cell lysate) A: Raji 12% SDS PAGE ADP-ribosylation factor 3 antibody, antibody diluted at 1:1000.
Immunocytochemistry/Immunofluorescence: ARF3 Antibody [NBP1-31004] - Immunofluorescence analysis of methanol-fixed HeLa, using ARF3 antibody at 1:500 dilution.
Immunohistochemistry-Paraffin: ARF3 Antibody [NBP1-31004] - Sample: Paraffin-embedded mouse fore brain. ARF3 antibody dilution: 1:500.
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
SOS2 Antibody
[Unconjugated]
AF6260
Western blot shows lysates of K562 human chronic myelogenous leukemia cell line and 293T human embryonic kidney cell line. PVDF Membrane was probed with 2 µg/mL of Goat Anti-Human SOS2 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF6260) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). A specific band was detected for SOS2 at approximately 160 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Species: Hu
Applications: WB
SOS1 Antibody
(SOS-01)
NB110-68800
Western Blot: SOS1 Antibody (SOS-01) [NB110-68800] - Analysis (reducing conditions) of human Sos using anti-human Sos (SOS-1). Lane 1: K562 human Caucasian chronic myeloid leukemia cell line Lane 2: RAJI human Burkitt lymphoma cell line
Immunocytochemistry/Immunofluorescence: SOS1 Antibody (SOS-01) [NB110-68800] - Staining of Sos in murine transformed fibroblasts using anti-Sos (SOS-01; red). Actin cytoskeleton was decorated by phalloidin (green) and cell nuclei stained with DAPI (blue).
Immunocytochemistry/Immunofluorescence: SOS1 Antibody (SOS-01) [NB110-68800] - Staining of Sos in human primary fibroblasts using anti-Sos (SOS-01; green). Actin cytoskeleton was decorated by phalloidin (red) and cell nuclei stained with DAPI (blue).
Species: Hu, Mu
Applications: WB, ICC/IF
c-jun Antibody
(5B1)
NBP2-37576
Western Blot: c-jun Antibody (5B1) [NBP2-37576] - Analysis using c-Jun mouse mAb against NIH/3T3 (1) and Cos7 (2) cell lysate.
Immunocytochemistry/Immunofluorescence: c-jun Antibody (5B1) [NBP2-37576] - Analysis of PC-2 cells using c-Jun mouse mAb (green). Red: Actin filaments have been labeled with Alexa Fluor-555 phalloidin.
Immunohistochemistry-Paraffin: c-jun Antibody (5B1) [NBP2-37576] - Analysis of human rectum cancer tissues using c-Jun mouse mAb with DAB staining.
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
RASGRF1 Antibody
NBP1-85727
Immunocytochemistry/Immunofluorescence: RASGRF1 Antibody [NBP1-85727] - Immunofluorescent staining of human cell line U-2 OS shows localization to nuclear speckles & the Golgi apparatus. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: RASGRF1 Antibody [NBP1-85727] - Staining of human colon shows strong cytoplasmic positivity in glandular cells.
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Filamin A Antibody
(4E1.0-1B2)
H00002316-M01
Western Blot: Filamin A Antibody (4E10-1B2) [H00002316-M01] - FLNA monoclonal antibody (M01), clone 4E10-1B2 Analysis of FLNA expression in HL-60.
Immunohistochemistry-Paraffin: Filamin A Antibody (4E10-1B2) [H00002316-M01] - Analysis of monoclonal antibody to FLNA on formalin-fixed paraffin-embedded human lymphoma tissue. Antibody concentration 1.5 ug/ml.
Proximity Ligation Assay: Filamin A Antibody (4E10-1B2) [H00002316-M01] - Analysis of protein-protein interactions between GP1BA and FLNA. HeLa cells were stained with anti-GP1BA rabbit purified polyclonal 1:1200 and anti-FLNA mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).
(11 Publications)
Species: Hu
Applications: WB, ELISA, IHC-P, PLA
Filamin A Antibody
(4E1.0-1B2)
H00002316-M01
Western Blot: Filamin A Antibody (4E10-1B2) [H00002316-M01] - FLNA monoclonal antibody (M01), clone 4E10-1B2 Analysis of FLNA expression in HL-60.
Immunohistochemistry-Paraffin: Filamin A Antibody (4E10-1B2) [H00002316-M01] - Analysis of monoclonal antibody to FLNA on formalin-fixed paraffin-embedded human lymphoma tissue. Antibody concentration 1.5 ug/ml.
Proximity Ligation Assay: Filamin A Antibody (4E10-1B2) [H00002316-M01] - Analysis of protein-protein interactions between GP1BA and FLNA. HeLa cells were stained with anti-GP1BA rabbit purified polyclonal 1:1200 and anti-FLNA mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).
(11 Publications)
Species: Hu
Applications: WB, ELISA, IHC-P, PLA
GEF-H1 Antibody
NBP2-21577
Western Blot: GEF-H1 Antibody [NBP2-21577] - Various whole cell extracts (30 ug) were separated by 7.5% SDS-PAGE, and the membrane was blotted with GEF-H1 antibody diluted at 1:500. The HRP-conjugated anti-rabbit IgG antibody (NBP2-19301) was used to detect the primary antibody.
Immunocytochemistry/Immunofluorescence: GEF-H1 Antibody [NBP2-21577] - HeLa cells were fixed in -20C 100% MeOH for 5 min. Green: ARHGEF2 protein stained by GEF-H1 antibody diluted at 1:500. Blue: Hoechst 33343 staining.
Immunohistochemistry-Frozen: GEF-H1 Antibody [NBP2-21577] - Frozen-sectioned mouse mouse cerebellum. Green: GEF-H1 stained by GEF-H1 antibody diluted at 1:250. Red: NF-H, stained by NF-H antibody [114] diluted at 1:500. Blue: Fluoroshield with DAPI. Antigen Retrieval: Citrate buffer, pH 6.0, 10 min.
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD
SLC2A4RG Antibody
(4C10)
H00056731-M02
Western Blot: SLC2A4RG Antibody (4C10) [H00056731-M02] - SLC2A4RG monoclonal antibody (M02), clone 4C10 Analysis of SLC2A4RG expression in HeLa.
Immunocytochemistry/Immunofluorescence: SLC2A4RG Antibody (4C10) [H00056731-M02] - Analysis of monoclonal antibody to SLC2A4RG on HeLa cell. Antibody concentration 10 ug/ml.
Species: Hu
Applications: WB, ELISA, ICC/IF
AKAP1 Antibody
NBP1-89172
Western Blot: AKAP1 Antibody [NBP1-89172] - Analysis in control (vector only transfected HEK293T lysate) and AKAP1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunohistochemistry-Paraffin: AKAP1 Antibody [NBP1-89172] - Staining of human heart muscle shows strong cytoplasmic positivity in myocytes.
(1 Publication)
Species: Hu
Applications: WB, IHC, IHC-P
JunD [p Ser255]
Antibody (JJ08-21)
NBP2-67861
Immunocytochemistry/Immunofluorescence: JunD [p Ser255] Antibody (JJ08-21) [NBP2-67861] - Staining Phospho-JunD(S255) in MCF-7 cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunohistochemistry-Paraffin: JunD [p Ser255] Antibody (JJ08-21) [NBP2-67861] - Analysis of paraffin-embedded mouse liver tissue using anti-Phospho-JunD(S255) antibody. Counter stained with hematoxylin.
Immunocytochemistry/Immunofluorescence: JunD [p Ser255] Antibody (JJ08-21) [NBP2-67861] - Staining Phospho-JunD(S255) in Hela cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
ARFGEF2 Antibody
NBP1-88607
ARFGEF2 Antibody
Species: Hu
Applications: WB, IHC, IHC-P

Publications for ARFGEF2 Antibody (NBP1-88607)(1)


Reviews for ARFGEF2 Antibody (NBP1-88607) (0)

There are no reviews for ARFGEF2 Antibody (NBP1-88607). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ARFGEF2 Antibody (NBP1-88607) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ARFGEF2 Products

Bioinformatics Tool for ARFGEF2 Antibody (NBP1-88607)

Discover related pathways, diseases and genes to ARFGEF2 Antibody (NBP1-88607). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ARFGEF2 Antibody (NBP1-88607)

Discover more about diseases related to ARFGEF2 Antibody (NBP1-88607).
 

Pathways for ARFGEF2 Antibody (NBP1-88607)

View related products by pathway.

PTMs for ARFGEF2 Antibody (NBP1-88607)

Learn more about PTMs related to ARFGEF2 Antibody (NBP1-88607).

Blogs on ARFGEF2

There are no specific blogs for ARFGEF2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ARFGEF2 Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol ARFGEF2