Home » ARFGEF2 » ARFGEF2 Antibodies » ARFGEF2 Antibody

ARFGEF2 Antibody

 (1 Publication)
 See All Related
Submit a Review

Images

 
(
Enlarge)
Western Blot: ARFGEF2 Antibody [NBP1-88607] - Analysis in human cell line CACO-2 and human cell line MCF-7.
Western Blot: ARFGEF2 Antibody [NBP1-88607] - Analysis in human cell line CACO-2 and human cell line MCF-7.
Immunohistochemistry-Paraffin: ARFGEF2 Antibody [NBP1-88607] - Staining of human small intestine shows distinct cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

ARFGEF2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: KPIQSKPQSPVIQAAAVSPKFVRLKHSQAQSKPTTPEKTDLTNGEHARSDSGKVSTENGDAPRERGSSLSGTDDGAQEVVKDILEDVVTSAIKAAEKHGLTEPERVLGELECQECAIPPGVDENSQTNGI
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ARFGEF2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
ARFGEF2 Protein (NBP1-88607PEP)
Publications
Read Publication using NBP1-88607.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 22291037)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ARFGEF2 Antibody

  • ADP-ribosylation factor guanine nucleotide-exchange factor 2 (brefeldinA-inhibited)
  • ARFGEP2
  • BIG2brefeldin A-inhibited guanine nucleotide-exchange protein 2
  • Brefeldin A-inhibited GEP 2
  • dJ1164I10.1
  • FLJ23723
  • PVNH2

Background

BIG2 promotes guanine-nucleotide exchange on ARF1, ARF5 and ARF6. Promotes the activation of ARF1/ARF5/ARF6 through replacement of GDP with GTP. [from: http://www.genecards.org/cgi-bin/carddisp.pl®gene=ARFGEF2&search=BIG2] ARFGEF2 plays an important role in vesicular and membrane trafficking from the trans-golgi network. It is also involved in the activation of ARFs (1,5, and 6) by accelerating replacement of bound GDP with GTP. It also acts as the activator of ADP-ribosylation factor GTPases that are essential for regulating vesicular traffic among intracellular organelles. [from: http://www.dsi.univ-paris5.fr/genatlas/fiche.php®symbol=ARFGEF2]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

ARFGEF1 Antibody
NBP1-88840
Immunohistochemistry-Paraffin: ARFGEF1 Antibody [NBP1-88840] - Staining of human cerebral cortex shows cytoplasmic immunoreactivity in neuronal cell bodies.
Immunohistochemistry-Paraffin: ARFGEF1 Antibody [NBP1-88840] - Staining of human cerebral cortex shows strong positivity in subsets of neurons.
Western Blot: ARFGEF1 Antibody [NBP1-88840] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10Lane 2: Human cell line RT-4
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
p19ARF/CDKN2A
Antibody - BSA Free
NB200-106
Immunohistochemistry: p19ARF/CDKN2A Antibody [NB200-106] - Adult mouse kidney (glomerulus). Image from verified customer review.
Western Blot: p19ARF/CDKN2A Antibody [NB200-106] - Analysis of p19ARF/CDKN2A in (A) NIH/3T3 and (B) MEF cells.
Immunocytochemistry/Immunofluorescence: p19ARF/CDKN2A Antibody [NB200-106] - Antibody was tested in MEF cells with DyLight 488 (green). Nuclei and alpha-tubulin were counterstained with DAPI (blue) and DyLight 550 (red).
(1 Review)
(46 Publications)
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
ARF1 Antibody (1D9)
NB300-505
Flow Cytometry: ARF1 Antibody (1D9) [NB300-505] - Analysis of 3T3 cells compared to an isotype control (blue).
Flow Cytometry: ARF1 Antibody (1D9) [NB300-505] - Analysis of Hela cells compared to an isotype control (blue).
Flow Cytometry: ARF1 Antibody (1D9) [NB300-505] - Analysis of MCF-7 cells compared to an isotype control (blue).
(13 Publications)
Species: Bv, Ca, Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, IP, WB
GBF1 Antibody
NBP2-16619
Western Blot: GBF1 Antibody [NBP2-16619] - Sample (30 ug of whole cell lysate) A: Hela 5% SDS PAGE gel, diluted at 1:1000.
Immunocytochemistry/Immunofluorescence: GBF1 Antibody [NBP2-16619] - Immunofluorescence analysis of methanol-fixed HeLa, using antibody at 1:200 dilution.
Immunohistochemistry-Paraffin: GBF1 Antibody [NBP2-16619] - Human colon carcinoma analysis. Sample: Paraffin-embedded colon carcinoma dilution: 1:500.
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Prostaglandin E
Synthase 2/PTGES2 Ant ...
NBP2-45904
Immunofluorescence: Prostaglandin E Synthase 2/PTGES2 Antibody (OTI2C3) [NBP2-45904] - Analysis of COS7 cells transiently transfected by pCMV6-ENTRY Prostaglandin E Synthase 2/PTGES2.
Immunohistochemistry: Prostaglandin E Synthase 2/PTGES2 Antibody (OTI2C3) [NBP2-45904] - Analysis of Human Kidney tissue.
Immunohistochemistry: Prostaglandin E Synthase 2/PTGES2 Antibody (OTI2C3) [NBP2-45904] - Analysis of Adenocarcinoma of Human colon tissue.
Species: Hu
Applications: ICC/IF, IF, IHC, WB
Thyroglobulin
Antibody (2H11 + 6E1)
NBP2-34294
Immunohistochemistry-Paraffin: Thyroglobulin Antibody (2H11 + 6E1) [NBP2-34294] - Analysis using Azide/BSA FREE version of NBP2-34294. Human Thyroid stained with Thyroglobulin Ab (2H11 + 6E1).
Immunohistochemistry: Thyroglobulin Antibody (2H11 + 6E1) [NBP2-34294] - Imaging of Mouse stomach tissue. Positive staining can only be observed inside the thyroid cells and the follicle in thyroid tissue. This image was submitted via customer Review.
Immunohistochemistry-Paraffin: Thyroglobulin Antibody (2H11 + 6E1) [NBP2-34294] - Thyroglobulin staining in thyroid tissue of normal C57 mouse (Red). Dilution is 1:100. IHC-P image submitted by a verified customer review.
(3 Reviews)
(1 Publication)
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P
ARF3 Antibody
NBP2-99493
Immunohistochemistry-Paraffin: ARF3 Antibody [NBP2-99493] - Immunochemical staining ARF3 in human breast carcinoma with rabbit polyclonal antibody at 1:300 dilution, formalin-fixed paraffin embedded sections.
Immunohistochemistry-Paraffin: ARF3 Antibody [NBP2-99493] - Immunochemical staining ARF3 in human colon carcinoma with rabbit polyclonal antibody at 1:300 dilution, formalin-fixed paraffin embedded sections.
Immunohistochemistry-Paraffin: ARF3 Antibody [NBP2-99493] - Immunochemical staining ARF3 in human kidney with rabbit polyclonal antibody at 1:300 dilution, formalin-fixed paraffin embedded sections.
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
SOS2 Antibody
[Unconjugated]
AF6260
Western blot shows lysates of K562 human chronic myelogenous leukemia cell line and 293T human embryonic kidney cell line. PVDF Membrane was probed with 2 µg/mL of Goat Anti-Human SOS2 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF6260) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). A specific band was detected for SOS2 at approximately 160 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Species: Hu
Applications: WB
SOS1 Antibody
(SOS-01) - BSA Free
NB110-68800
Western Blot: SOS1 Antibody (SOS-01) [NB110-68800] - Analysis (reducing conditions) of human Sos using anti-human Sos (SOS-1). Lane 1: K562 human Caucasian chronic myeloid leukemia cell line Lane 2: RAJI human Burkitt lymphoma cell line
Immunocytochemistry/Immunofluorescence: SOS1 Antibody (SOS-01) [NB110-68800] - Staining of Sos in human primary fibroblasts using anti-Sos (SOS-01; green). Actin cytoskeleton was decorated by phalloidin (red) and cell nuclei stained with DAPI (blue).
Immunocytochemistry/Immunofluorescence: SOS1 Antibody (SOS-01) [NB110-68800] - Staining of Sos in murine transformed fibroblasts using anti-Sos (SOS-01; red). Actin cytoskeleton was decorated by phalloidin (green) and cell nuclei stained with DAPI (blue).
Species: Hu, Mu
Applications: ICC/IF, WB
c-jun [p Ser63]
Antibody (1018Y) [Unc ...
MAB8930
Western blot shows lysates of HEK293T human embryonic kidney cell line untreated (-) or treated (+) with 20 mJ/cm2 ultraviolet light (UV) with a 30 minute recovery. PVDF membrane was probed with 0.5 μg/mL of Rabbit Anti-Human Phospho-c‑Jun (S63) Monoclonal Antibody (Catalog # MAB8930) followed by HRP-conjugated Anti-Rabbit IgG Secondary Antibody (Catalog # HAF008). A specific band was detected for Phospho-c‑Jun (S63) at approximately 45 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
c‑Junphosphorylated at S63 was detected in immersion fixed HeLa human cervical epithelial carcinoma cell line treated with Anisomycin using Rabbit Anti-HumanPhospho-c‑Jun (S63) Monoclonal Antibody (Catalog # MAB8930) at 1 μg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Mouse IgG Secondary Antibody (red; Catalog # NL007) and counterstained with DAPI (blue). Specific staining was localized to nuclei. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
Simple Western lane view shows lysates of HEK293T human embryonic kidney cell line untreated (-) or treated (+) with 20 mJ/cm2 ultraviolet light (UV) with a 30 minute recovery, loaded at 0.2 mg/mL. A specific band was detected for Phospho-c‑Jun (S63) at approximately 49 kDa (as indicated) using 5 μg/mL of Rabbit Anti-Human Phospho-c‑Jun (S63) Monoclonal Antibody (Catalog # MAB8930) . This experiment was conducted under reducing conditions and using the 12-230 kDa separation system. Non-specific interaction with the 230 kDa Simple Western standard may be seen with this antibody.
(1 Review)
(2 Publications)
Species: Hu
Applications: ICC, Simple Western, WB
RASGRF1 Antibody
NBP1-85727
Immunohistochemistry-Paraffin: RASGRF1 Antibody [NBP1-85727] - Staining of human colon shows strong cytoplasmic positivity in glandular cells.
Immunocytochemistry/Immunofluorescence: RASGRF1 Antibody [NBP1-85727] - Immunofluorescent staining of human cell line U-2 OS shows localization to nuclear speckles & the Golgi apparatus. Antibody staining is shown in green.
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Filamin A Antibody
(4E10-1B2)
H00002316-M01
Western Blot: Filamin A Antibody (4E10-1B2) [H00002316-M01] - FLNA monoclonal antibody (M01), clone 4E10-1B2 Analysis of FLNA expression in HL-60.
ELISA: Filamin A Antibody (4E10-1B2) [H00002316-M01] - Filamin A Antibody (4E10-1B2) [H00002316-M01] - Detection limit for recombinant GST tagged FLNA is approximately 0.03ng/ml as a capture antibody.
Proximity Ligation Assay: Filamin A Antibody (4E10-1B2) [H00002316-M01] - Analysis of protein-protein interactions between GP1BA and FLNA. HeLa cells were stained with anti-GP1BA rabbit purified polyclonal 1:1200 and anti-FLNA mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).
(11 Publications)
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, PLA, WB
Filamin A Antibody
(4E10-1B2)
H00002316-M01
Western Blot: Filamin A Antibody (4E10-1B2) [H00002316-M01] - FLNA monoclonal antibody (M01), clone 4E10-1B2 Analysis of FLNA expression in HL-60.
ELISA: Filamin A Antibody (4E10-1B2) [H00002316-M01] - Filamin A Antibody (4E10-1B2) [H00002316-M01] - Detection limit for recombinant GST tagged FLNA is approximately 0.03ng/ml as a capture antibody.
Proximity Ligation Assay: Filamin A Antibody (4E10-1B2) [H00002316-M01] - Analysis of protein-protein interactions between GP1BA and FLNA. HeLa cells were stained with anti-GP1BA rabbit purified polyclonal 1:1200 and anti-FLNA mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).
(11 Publications)
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, PLA, WB
GEF-H1 Antibody
NBP2-21577
Western Blot: GEF-H1 Antibody [NBP2-21577] - A. 30 ug 293T whole cell lysate/extract B. 30 ug A431 whole cell lysate/extract C. 30 ug HeLa whole cell lysate/extract D. 30 ug HepG2 whole cell lysate/extract5% SDS-PAGE GEF-H1 antibody dilution: 1:2000. The HRP-conjugated anti-rabbit IgG antibody (NBP2-19301) was used to detect the primary antibody.
Western Blot: GEF-H1 Antibody [NBP2-21577] - A. 30 ug Neuro2A whole cell lysate/extract B. 30 ug GL261 whole cell lysate/extract C. 30 ug C8D30 whole cell lysate/extract D. 30 ug NIH-3T3 whole cell lysate/extract E. 30 ug BCL-1 whole cell lysate/extract F. 30 ug Raw 264.7 whole cell lysate/extract G. 30 ug C2Cl2 whole cell lysate/extract 5% SDS-PAGEGEF-H1 antibody dilution: 1:1000. The HRP-conjugated anti-rabbit IgG antibody (NBP2-19301) was used to detect the primary antibody.
Western Blot: GEF-H1 Antibody [NBP2-21577] - A. 30 ug 293T whole cell lysate/extract B. 30 ug A431 whole cell lysate/extract C. 30 ug HeLa whole cell lysate/extract D. 30 ug HepG2 whole cell lysate/extract5% SDS-PAGE GEF-H1 antibody dilution: 1:2000 The HRP-conjugated anti-rabbit IgG antibody (NBP2-19301) was used to detect the primary antibody.
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, WB
SLC2A4RG Antibody
(4C10)
H00056731-M02
Western Blot: SLC2A4RG Antibody (4C10) [H00056731-M02] - SLC2A4RG monoclonal antibody (M02), clone 4C10 Analysis of SLC2A4RG expression in HeLa.
Immunocytochemistry/Immunofluorescence: SLC2A4RG Antibody (4C10) [H00056731-M02] - Analysis of monoclonal antibody to SLC2A4RG on HeLa cell. Antibody concentration 10 ug/ml.
Species: Hu
Applications: ELISA, ICC/IF, WB
AKAP1 Antibody
NBP1-89172
Western Blot: AKAP1 Antibody [NBP1-89172] - Analysis in control (vector only transfected HEK293T lysate) and AKAP1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunohistochemistry-Paraffin: AKAP1 Antibody [NBP1-89172] - Staining of human cerebral cortex shows moderate to strong cytoplasmic positivity in neurons.
Immunohistochemistry-Paraffin: AKAP1 Antibody [NBP1-89172] - Staining of human skeletal muscle shows strong cytoplasmic positivity in myocytes.
(1 Publication)
Species: Hu
Applications: IHC, IHC-P, WB
JunD Antibody
(512709)
MAB5526
Western blot shows lysates of HeLa human cervical epithelial carcinoma cell line, 293T human embryonic kidney cell line, Jurkat human acute T cell leukemia cell line, and NIH‑3T3 mouse embryonic fibroblast cell line. PVDF membrane was probed with 1 µg/mL of Human/Mouse JunD Monoclonal Antibody (Catalog # MAB5526) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # HAF007). Specific bands were detected for JunD at approximately 40 kDa and 45 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
(2 Publications)
Species: Hu, Mu
Applications: WB
ARFGEF2 Antibody
NBP1-88607
ARFGEF2 Antibody
Species: Hu
Applications: WB, IHC, IHC-P

Publications for ARFGEF2 Antibody (NBP1-88607)(1)


Reviews for ARFGEF2 Antibody (NBP1-88607) (0)

There are no reviews for ARFGEF2 Antibody (NBP1-88607). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ARFGEF2 Antibody (NBP1-88607) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ARFGEF2 Products

Bioinformatics Tool for ARFGEF2 Antibody (NBP1-88607)

Discover related pathways, diseases and genes to ARFGEF2 Antibody (NBP1-88607). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ARFGEF2 Antibody (NBP1-88607)

Discover more about diseases related to ARFGEF2 Antibody (NBP1-88607).
 

Pathways for ARFGEF2 Antibody (NBP1-88607)

View related products by pathway.

PTMs for ARFGEF2 Antibody (NBP1-88607)

Learn more about PTMs related to ARFGEF2 Antibody (NBP1-88607).
 

Research Areas for ARFGEF2 Antibody (NBP1-88607)

Find related products by research area.

Blogs on ARFGEF2

There are no specific blogs for ARFGEF2, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ARFGEF2 Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol ARFGEF2