ARFGEF2 Antibody

Images

 
Western Blot: ARFGEF2 Antibody [NBP1-88607] - Analysis in human cell line CACO-2 and human cell line MCF-7.
Immunohistochemistry-Paraffin: ARFGEF2 Antibody [NBP1-88607] - Staining of human small intestine shows distinct cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ARFGEF2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: KPIQSKPQSPVIQAAAVSPKFVRLKHSQAQSKPTTPEKTDLTNGEHARSDSGKVSTENGDAPRERGSSLSGTDDGAQEVVKDILEDVVTSAIKAAEKHGLTEPERVLGELECQECAIPPGVDENSQTNGI
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ARFGEF2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
ARFGEF2 Protein (NBP1-88607PEP)
Publications
Read Publication using NBP1-88607.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 22291037)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ARFGEF2 Antibody

  • ADP-ribosylation factor guanine nucleotide-exchange factor 2 (brefeldinA-inhibited)
  • ARFGEP2
  • BIG2brefeldin A-inhibited guanine nucleotide-exchange protein 2
  • Brefeldin A-inhibited GEP 2
  • dJ1164I10.1
  • FLJ23723
  • PVNH2

Background

BIG2 promotes guanine-nucleotide exchange on ARF1, ARF5 and ARF6. Promotes the activation of ARF1/ARF5/ARF6 through replacement of GDP with GTP. [from: http://www.genecards.org/cgi-bin/carddisp.pl®gene=ARFGEF2&search=BIG2] ARFGEF2 plays an important role in vesicular and membrane trafficking from the trans-golgi network. It is also involved in the activation of ARFs (1,5, and 6) by accelerating replacement of bound GDP with GTP. It also acts as the activator of ADP-ribosylation factor GTPases that are essential for regulating vesicular traffic among intracellular organelles. [from: http://www.dsi.univ-paris5.fr/genatlas/fiche.php®symbol=ARFGEF2]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-88840
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NB200-106
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
NB300-505
Species: Bv, Ca, Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, IP, WB
NBP2-16619
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-45904
Species: Hu
Applications: ICC/IF, IF, IHC, WB
NBP2-34294
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P
NBP2-99493
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
AF6260
Species: Hu
Applications: WB
NB110-68800
Species: Hu, Mu
Applications: ICC/IF, WB
MAB8930
Species: Hu
Applications: ICC, Simple Western, WB
NBP1-85727
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00002316-M01
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, PLA, WB
H00002316-M01
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, PLA, WB
NBP2-21577
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, WB
H00056731-M02
Species: Hu
Applications: ELISA, ICC/IF, WB
NBP1-89172
Species: Hu
Applications: IHC, IHC-P, WB
MAB5526
Species: Hu, Mu
Applications: WB
NBP1-88607
Species: Hu
Applications: WB, IHC, IHC-P

Publications for ARFGEF2 Antibody (NBP1-88607)(1)

Reviews for ARFGEF2 Antibody (NBP1-88607) (0)

There are no reviews for ARFGEF2 Antibody (NBP1-88607). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ARFGEF2 Antibody (NBP1-88607) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ARFGEF2 Products

Bioinformatics Tool for ARFGEF2 Antibody (NBP1-88607)

Discover related pathways, diseases and genes to ARFGEF2 Antibody (NBP1-88607). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ARFGEF2 Antibody (NBP1-88607)

Discover more about diseases related to ARFGEF2 Antibody (NBP1-88607).
 

Pathways for ARFGEF2 Antibody (NBP1-88607)

View related products by pathway.

PTMs for ARFGEF2 Antibody (NBP1-88607)

Learn more about PTMs related to ARFGEF2 Antibody (NBP1-88607).
 

Research Areas for ARFGEF2 Antibody (NBP1-88607)

Find related products by research area.

Blogs on ARFGEF2

There are no specific blogs for ARFGEF2, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ARFGEF2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ARFGEF2