![Western Blot: ARFGEF2 Antibody [NBP1-88607] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10. Lane 2: CACO-2](http://images.novusbio.com/fullsize2/ARFGEF2 Antibody-Western Blot-NBP1-88607-img0003.jpg "Western Blot: ARFGEF2 Antibody [NBP1-88607] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10. Lane 2: CACO-2")
| Reactivity | HuSpecies Glossary |
| Applications | WB, IHC, IHC-P |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: KPIQSKPQSPVIQAAAVSPKFVRLKHSQAQSKPTTPEKTDLTNGEHARSDSGKVSTENGDAPRERGSSLSGTDDGAQEVVKDILEDVVTSAIKAAEKHGLTEPERVLGELECQECAIPPGVDENSQTNGI |
| Specificity | Specificity of human ARFGEF2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | ARFGEF2 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
| Publication using NBP1-88607 | Applications | Species |
|---|---|---|
| Christis C, Munro S. The small G protein Arl1 directs the trans-Golgi-specific targeting of the Arf1 exchange factors BIG1 and BIG2. J Cell Biol 2012 Feb 6 [PMID: 22291037] |
Secondary Antibodies |
Isotype Controls |
Diseases for ARFGEF2 Antibody (NBP1-88607)Discover more about diseases related to ARFGEF2 Antibody (NBP1-88607).
| Pathways for ARFGEF2 Antibody (NBP1-88607)View related products by pathway.
|
PTMs for ARFGEF2 Antibody (NBP1-88607)Learn more about PTMs related to ARFGEF2 Antibody (NBP1-88607).
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | ARFGEF2 |
![Immunohistochemistry-Paraffin: ARFGEF2 Antibody [NBP1-88607] - Staining of human small intestine shows distinct cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize2/ARFGEF2-Antibody-Immunohistochemistry-Paraffin-NBP1-88607-img0001.jpg "Immunohistochemistry-Paraffin: ARFGEF2 Antibody [NBP1-88607] - Staining of human small intestine shows distinct cytoplasmic positivity in glandular cells.")
![Western Blot: ARFGEF1 Antibody [NBP1-88840] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10Lane 2: Human cell line RT-4](http://images.novusbio.com/fullsize2/ARFGEF1-Antibody-Western-Blot-NBP1-88840-img0007.jpg)
![Immunocytochemistry/Immunofluorescence: ARFGEF1 Antibody [NBP1-88840] - Staining of mouse piriform cortex shows neuronal staining in various layers.](http://images.novusbio.com/fullsize2/ARFGEF1-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-88840-img0012.jpg)
![Immunohistochemistry-Paraffin: ARFGEF1 Antibody [NBP1-88840] - Staining of human cerebral cortex shows strong positivity in subsets of neurons.](http://images.novusbio.com/fullsize2/ARFGEF1-Antibody-Immunohistochemistry-Paraffin-NBP1-88840-img0006.jpg)
![Western Blot: p19ARF Antibody [NB200-106] - WB analysis of p19ARF in 1. NIH/3T3 and B. MEF cell lysate.](http://images.novusbio.com/fullsize2/p19ARF-Antibody-Western-Blot-NB200-106-img0002.jpg)
![Immunocytochemistry/Immunofluorescence: p19ARF Antibody [NB200-106] - Adult mouse kidney (glomerulus). Image from verified customer review.](http://images.novusbio.com/fullsize2/p19ARF-Antibody-Immunocytochemistry-Immunofluorescence-NB200-106-img0006.jpg)
![Immunohistochemistry-Paraffin: p19ARF Antibody [NB200-106] - IHC analysis of formalin fixed paraffin-embedded (FFPE) mouse spleen using p19ARF antibody at 10 ug/ml on a Bond Rx autostainer (Leica Biosystems). The assay involved 20 minutes of heat induced antigen retrieval (HIER) using 10mM sodium citrate buffer (pH 6.0) and endogenous peroxidase quenching with peroxide block. The sections were incubated with primary antibody for 30 minutes and Bond Polymer Refine Detection (Leica Biosystems) with DAB was used for signal development followed by counterstaining with hematoxylin. Whole slide scanning and capturing of representative images was performed using Aperio AT2 (Leica Biosystems). Nuclear staining in the germinal centers of spleen was observed. Staining was performed by Histowiz.](http://images.novusbio.com/fullsize2/p19ARF-Antibody-Immunohistochemistry-Paraffin-NB200-106-img0005.jpg)
![Western Blot: ARF1 Antibody (1D9) [NB300-505] - Analysis of canine heart extract.](http://images.novusbio.com/fullsize2/ARF1-Antibody-(1D9)-Western-Blot-NB300-505-img0005.jpg)
![Immunocytochemistry/Immunofluorescence: ARF1 Antibody (1D9) [NB300-505] - Analysis of ADP-Ribosylation Factor (green), F-Actin staining with Phalloidin (red) and nuclei with DAPI (blue) is shown.](http://images.novusbio.com/fullsize2/ARF1-Antibody-(1D9)-Immunocytochemistry-Immunofluorescence-NB300-505-img0008.jpg)
![Immunohistochemistry-Paraffin: ARF1 Antibody (1D9) [NB300-505] - Both normal and cancer biopsies of deparaffinized Human colon carcinoma tissues.](http://images.novusbio.com/fullsize2/ARF1-Antibody-(1D9)-Immunohistochemistry-Paraffin-NB300-505-img0015.jpg)
![Immunohistochemistry: GBF1 Antibody [NBP1-06526] - Sample: FFPE section of human prostate carcinoma. Antibody: Affinity purified rabbit anti-GBF1 used at a dilution of 1:200 (1ug/ml). Detection: DAB](http://images.novusbio.com/fullsize2/GBF1 Antibody-Immunohistochemistry-NBP1-06526-img0004.jpg)
![Immunoprecipitation: GBF1 Antibody [NBP1-06526] - Whole cell lysate from HeLa (5, 15 and 50 ug for WB; 1 mg for IP, 20% of IP loaded), 293T (T; 50 ug) and mouse NIH3T3 (M; 50 ug) cells. NBP1-06526 used for WB at 0.04 ug/ml (A) and 1 ug/ml (B) and used for IP at 3 ug/mg lysate. GBF1 was also immunoprecipitated by NBP1-06525 which recognizes an upstream epitope.](http://images.novusbio.com/fullsize2/GBF1-Antibody-Immunoprecipitation-NBP1-06526-img0006.jpg)
![Western Blot: Prostaglandin E Synthase 2/PTGES2 Antibody (2C3) [NBP2-45904] - Analysis of HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY PTGES2.](http://images.novusbio.com/fullsize2/Prostaglandin E Synthase 2-PTGES2 Antibody (2C3)-Western Blot-NBP2-45904-img0009.jpg)
![Immunohistochemistry: Prostaglandin E Synthase 2/PTGES2 Antibody (2C3) [NBP2-45904] - Analysis of Human pancreas tissue.](http://images.novusbio.com/fullsize2/Prostaglandin-E-Synthase-2-PTGES2-Antibody-(2C3)-Immunohistochemistry-NBP2-45904-img0008.jpg)
![Immunohistochemistry: Prostaglandin E Synthase 2/PTGES2 Antibody (2C3) [NBP2-45904] - Analysis of Human Kidney tissue.](http://images.novusbio.com/fullsize2/Prostaglandin-E-Synthase-2-PTGES2-Antibody-(2C3)-Immunohistochemistry-NBP2-45904-img0002.jpg)
![Immunohistochemistry-Paraffin: Thyroglobulin Antibody (2H11+6E1) [NBP2-34294] - Thyroglobulin staining in thyroid tissue of normal C57 mouse (Red). Dilution is 1:100. This image was submitted via customer Review.](http://images.novusbio.com/fullsize2/Thyroglobulin-Antibody-(2H11+6E1)-Immunohistochemistry-Paraffin-NBP2-34294-img0005.jpg)
![Immunohistochemistry-Paraffin: Thyroglobulin Antibody (2H11+6E1) [NBP2-34294] - Analysis using Azide/BSA FREE version of NBP2-34294. Human Thyroid stained with Thyroglobulin Ab (2H11 + 6E1).](http://images.novusbio.com/fullsize2/Thyroglobulin-Antibody-(2H11+6E1)-Immunohistochemistry-Paraffin-NBP2-34294-img0003.jpg)
![Immunohistochemistry: Thyroglobulin Antibody (2H11+6E1) [NBP2-34294] - Imaging of Mouse stomach tissue. Positive staining can only be observed inside the thyroid cells and the follicle in thyroid tissue. This image was submitted via customer Review.](http://images.novusbio.com/fullsize2/Thyroglobulin-Antibody-(2H11+6E1)-Immunohistochemistry-NBP2-34294-img0004.jpg)
![Western Blot: ARF3 Antibody [NBP1-31004] - Sample (30 ug of whole cell lysate) A: Raji 12% SDS PAGE ADP-ribosylation factor 3 antibody, antibody diluted at 1:1000.](http://images.novusbio.com/fullsize2/ARF3 Antibody-Western Blot-NBP1-31004-img0003.jpg)
![Immunocytochemistry/Immunofluorescence: ARF3 Antibody [NBP1-31004] - Immunofluorescence analysis of methanol-fixed HeLa, using ARF3 antibody at 1:500 dilution.](http://images.novusbio.com/fullsize2/ARF3-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-31004-img0004.jpg)
![Immunohistochemistry-Paraffin: ARF3 Antibody [NBP1-31004] - Sample: Paraffin-embedded mouse fore brain. ARF3 antibody dilution: 1:500.](http://images.novusbio.com/fullsize2/ARF3-Antibody-Immunohistochemistry-Paraffin-NBP1-31004-img0007.jpg)
![Western Blot: SOS1 Antibody (SOS-01) [NB110-68800] - Analysis (reducing conditions) of human Sos using anti-human Sos (SOS-1). Lane 1: K562 human Caucasian chronic myeloid leukemia cell line Lane 2: RAJI human Burkitt lymphoma cell line](http://images.novusbio.com/fullsize2/SOS1-Antibody-(SOS-01)-Western-Blot-NB110-68800-img0003.jpg)
![Immunocytochemistry/Immunofluorescence: SOS1 Antibody (SOS-01) [NB110-68800] - Staining of Sos in murine transformed fibroblasts using anti-Sos (SOS-01; red). Actin cytoskeleton was decorated by phalloidin (green) and cell nuclei stained with DAPI (blue).](http://images.novusbio.com/fullsize2/SOS1-Antibody-(SOS-01)-Immunocytochemistry-Immunofluorescence-NB110-68800-img0005.jpg)
![Immunocytochemistry/Immunofluorescence: SOS1 Antibody (SOS-01) [NB110-68800] - Staining of Sos in human primary fibroblasts using anti-Sos (SOS-01; green). Actin cytoskeleton was decorated by phalloidin (red) and cell nuclei stained with DAPI (blue).](http://images.novusbio.com/fullsize2/SOS1-Antibody-(SOS-01)-Immunocytochemistry-Immunofluorescence-NB110-68800-img0004.jpg)
![Western Blot: c-jun Antibody (5B1) [NBP2-37576] - Western blot analysis using c-Jun mouse mAb against NIH/3T3 (1) and Cos7 (2) cell lysate.](http://images.novusbio.com/fullsize2/c-jun-Antibody-(5B1)-Western-Blot-NBP2-37576-img0003.jpg)
![Immunocytochemistry/Immunofluorescence: c-jun Antibody (5B1) [NBP2-37576] - Immunofluorescence analysis of PC-2 cells using c-Jun mouse mAb (green). Red: Actin filaments have been labeled with Alexa Fluor-555 phalloidin.](http://images.novusbio.com/fullsize2/c-jun-Antibody-(5B1)-Immunocytochemistry-Immunofluorescence-NBP2-37576-img0004.jpg)
![Immunohistochemistry: c-jun Antibody (5B1) [NBP2-37576] - Immunohistochemical analysis of paraffin-embedded human rectum cancer tissues using c-Jun mouse mAb with DAB staining.](http://images.novusbio.com/fullsize2/c-jun-Antibody-(5B1)-Immunohistochemistry-NBP2-37576-img0007.jpg)
![Immunocytochemistry/Immunofluorescence: RASGRF1 Antibody [NBP1-85727] - Immunofluorescent staining of human cell line U-2 OS shows localization to nuclear speckles & the Golgi apparatus. Antibody staining is shown in green.](http://images.novusbio.com/fullsize2/RASGRF1 Antibody-Immunocytochemistry-Immunofluorescence-NBP1-85727-img0005.jpg)
![Immunohistochemistry-Paraffin: RASGRF1 Antibody [NBP1-85727] - Staining of human colon shows strong cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize2/RASGRF1-Antibody-Immunohistochemistry-NBP1-85727-img0003.jpg)
![Western Blot: Filamin A Antibody (4E10-1B2) [H00002316-M01] - FLNA monoclonal antibody (M01), clone 4E10-1B2 Analysis of FLNA expression in HL-60.](http://images.novusbio.com/fullsize2/Filamin A Antibody (4E10-1B2)-Western Blot-H00002316-M01-img0009.jpg)
![Immunohistochemistry-Paraffin: Filamin A Antibody (4E10-1B2) [H00002316-M01] - Analysis of monoclonal antibody to FLNA on formalin-fixed paraffin-embedded human lymphoma tissue. Antibody concentration 1.5 ug/ml.](http://images.novusbio.com/fullsize2/Filamin-A-Antibody-(4E10-1B2)-Immunohistochemistry-Paraffin-H00002316-M01-img0007.jpg)
![Proximity Ligation Assay: Filamin A Antibody (4E10-1B2) [H00002316-M01] - Analysis of protein-protein interactions between GP1BA and FLNA. HeLa cells were stained with anti-GP1BA rabbit purified polyclonal 1:1200 and anti-FLNA mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).](http://images.novusbio.com/fullsize2/Filamin-A-Antibody-(4E10-1B2)-Proximity-Ligation-Assay-H00002316-M01-img0005.jpg)
![Western Blot: GEF-H1 Antibody [NBP2-21577] - Immunoprecipitation of GEF-H1 protein from 293T whole cell extracts using 5 ug of GEF-H1 antibody. Western blot analysis was performed using GEF-H1 antibody. EasyBlot anti-Rabbit IgG was used as a secondary reagent.](http://images.novusbio.com/fullsize2/GEF-H1-Antibody-Western-Blot-NBP2-21577-img0010.jpg)
![Immunocytochemistry/Immunofluorescence: GEF-H1 Antibody [NBP2-21577] - HeLa cells were fixed in -20C 100% MeOH for 5 min. Green: ARHGEF2 protein stained by GEF-H1 antibody diluted at 1:500. Blue: Hoechst 33343 staining.](http://images.novusbio.com/fullsize2/GEF-H1 Antibody-Immunocytochemistry-Immunofluorescence-NBP2-21577-img0006.jpg)
![Immunohistochemistry-Paraffin: GEF-H1 Antibody [NBP2-21577] - Paraffin-embedded mouse testis. GEF-H1 antibody dilution: 1:500.](http://images.novusbio.com/fullsize2/GEF-H1-Antibody-Immunohistochemistry-Paraffin-NBP2-21577-img0012.jpg)
![Western Blot: SLC2A4RG Antibody (4C10) [H00056731-M02] - SLC2A4RG monoclonal antibody (M02), clone 4C10 Analysis of SLC2A4RG expression in HeLa.](http://images.novusbio.com/fullsize2/SLC2A4RG Antibody (4C10)-Western Blot-H00056731-M02-img0005.jpg)
![Immunocytochemistry/Immunofluorescence: SLC2A4RG Antibody (4C10) [H00056731-M02] - Analysis of monoclonal antibody to SLC2A4RG on HeLa cell. Antibody concentration 10 ug/ml.](http://images.novusbio.com/fullsize2/SLC2A4RG-Antibody-(4C10)-Immunocytochemistry-Immunofluorescence-H00056731-M02-img0004.jpg)
![Western Blot: AKAP1 Antibody [NBP1-89172] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).](http://images.novusbio.com/fullsize2/AKAP1 Antibody-Western Blot-NBP1-89172-img0004.jpg)
![Immunohistochemistry-Paraffin: AKAP1 Antibody [NBP1-89172] - Staining of human heart muscle shows strong cytoplasmic positivity in myocytes.](http://images.novusbio.com/fullsize2/AKAP1-Antibody-Immunohistochemistry-Paraffin-NBP1-89172-img0002.jpg)
![Immunocytochemistry/Immunofluorescence: JunD [p Ser255] Antibody (JJ08-21) [NBP2-67861] - Staining Phospho-JunD(S255) in MCF-7 cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.](http://images.novusbio.com/fullsize2/JunD-[p-Ser255]-Antibody-(JJ08-21)-Immunocytochemistry-Immunofluorescence-NBP2-67861-img0003.jpg)
![Immunohistochemistry-Paraffin: JunD [p Ser255] Antibody (JJ08-21) [NBP2-67861] - Analysis of paraffin-embedded mouse liver tissue using anti-Phospho-JunD(S255) antibody. Counter stained with hematoxylin.](http://images.novusbio.com/fullsize2/JunD-[p-Ser255]-Antibody-(JJ08-21)-Immunohistochemistry-Paraffin-NBP2-67861-img0006.jpg)
![Immunocytochemistry/Immunofluorescence: JunD [p Ser255] Antibody (JJ08-21) [NBP2-67861] - Staining Phospho-JunD(S255) in Hela cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.](http://images.novusbio.com/fullsize2/JunD-[p-Ser255]-Antibody-(JJ08-21)-Immunocytochemistry-Immunofluorescence-NBP2-67861-img0001.jpg)
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - FLOW analysis of Mouse CD4+ T cells that were stimulated with anti-CD3/CD28 beads and insulin (1ug/mL) for 5 days in culture media with additional glucose provided. PE conjugated Glut1 antibody stained cells (NB110-39113PE, Orange) were included as positive control which were compared with Rb IgG PE, NBP2-24983 as Isotype Control (Blue) as well as with fluorescence minus one/FMO control (Red) [Image submitted by Verified Customer - see Review for Protocol Details]. Image using the PE form of this antibody.](http://images.novusbio.com/images2/Rabbit-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0005.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - FLOW analysis of Mouse CD4+ T cells that were stimulated with anti-CD3/CD28 beads and insulin (1ug/mL) for 5 days in culture media with additional glucose provided. PE conjugated Glut1 antibody stained cells (NB110-39113PE, Orange) were included as positive control which were compared with Rb IgG PE, NBP2-24983 as Isotype Control (Blue) as well as with fluorescence minus one/FMO control (Red) [Image submitted by Verified Customer - see Review for Protocol Details]. Image using the PE form of this antibody.")