PRAGMIN Antibody

Images

 
Western Blot: PRAGMIN Antibody [NBP1-87473] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11Lane 2: Human cell line RT-4Lane 3: Human cell line U-251MG sp
Immunocytochemistry/ Immunofluorescence: PRAGMIN Antibody [NBP1-87473] - Staining of human cell line U-251 MG shows positivity in cytoplasm, centrosome & nucleus but excluded from the nucleoli.
Immunohistochemistry-Paraffin: PRAGMIN Antibody [NBP1-87473] - Staining of human colon shows strong cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: PRAGMIN Antibody [NBP1-87473] - Staining of human colon shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PRAGMIN Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:TNGVAISDPSRCPQPAASSASEQRRPRFQAGTWSRQCRIEEEEEVEQELLSHSWGRETKNGPTDHSNSTTWHRLHPTDGSSGQNSKVGTGMSKSASFAFEFPKD
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SGK223
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:10-1:20
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
PRAGMIN Protein (NBP1-87473PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PRAGMIN Antibody

  • DKFZp761P0423
  • homolog of rat pragma of Rnd2
  • PRAGMIN
  • sugen kinase 223
  • tyrosine-protein kinase SgK223

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-44192
Species: Hu
Applications: WB, ELISA, ICC/IF, IP
NBP2-37568
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP2-56429
Species: Hu
Applications: WB, ICC/IF
NB100-91273
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF2685
Species: Hu
Applications: WB, Simple Western, IHC
NBP2-17173
Species: Hu
Applications: WB
NB300-268
Species: Hu, Mu, Bv, Ce
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
AF4877
Species: Hu
Applications: WB
NBP2-27202
Species: Hu, Mu, Rt, Po, Ca, Ch, ChHa, Fe, Op, Other, Pm
Applications: WB, Simple Western
NBP2-00948
Species: Hu
Applications: WB, Flow, ICC/IF
H00006464-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, PLA
MAB38461
Species: Hu
Applications: WB, IHC
NBP1-85951
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-82112
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
H00000420-B01P
Species: Hu
Applications: WB
NBP1-83701
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-31308
Species: Hu, Mu, Rt, Bv
Applications: WB, ICC/IF, IHC, IHC-P
MAB3035
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC

Publications for PRAGMIN Antibody (NBP1-87473) (0)

There are no publications for PRAGMIN Antibody (NBP1-87473).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PRAGMIN Antibody (NBP1-87473) (0)

There are no reviews for PRAGMIN Antibody (NBP1-87473). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for PRAGMIN Antibody (NBP1-87473) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PRAGMIN Products

Bioinformatics Tool for PRAGMIN Antibody (NBP1-87473)

Discover related pathways, diseases and genes to PRAGMIN Antibody (NBP1-87473). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PRAGMIN Antibody (NBP1-87473)

Discover more about diseases related to PRAGMIN Antibody (NBP1-87473).
 

Pathways for PRAGMIN Antibody (NBP1-87473)

View related products by pathway.

PTMs for PRAGMIN Antibody (NBP1-87473)

Learn more about PTMs related to PRAGMIN Antibody (NBP1-87473).
 

Research Areas for PRAGMIN Antibody (NBP1-87473)

Find related products by research area.

Blogs on PRAGMIN

There are no specific blogs for PRAGMIN, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PRAGMIN Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SGK223