ARA54 Antibody

Product Discontinued

ARA54 Antibody Summary

• Immunogen: Synthetic peptides corresponding to the N terminal of Rnf14. Immunizing peptide sequence SAEDLEAQEDELLALASIYDGDEFRKAESVQGGETRIYLDLPQNFKIFVS.
• Predicted Species: Human (100%), Mouse (93%), Bovine (100%), Guinea Pig (100%), Rabbit (100%), Canine (100%), Equine (100%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: RNF14
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:100-1:2000
• Application Notes: This is a rabbit polyclonal antibody against Rnf14 and was validated on Western blot.
• Theoretical MW: 52 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS & 2% Sucrose.
• Preservative: 0.09% Sodium Azide
• Purity: Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for ARA54 Antibody

• Androgen receptor-associated protein 54
• ARA54
• ARA54androgen receptor associated protein 54
• EC 6.3.2.-
• HFB30
• HFB30E3 ubiquitin-protein ligase RNF14
• ring finger protein 14FLJ26004
• RNF14
• Triad2 protein
• TRIAD2

Background

The function of this protein remains unknown.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: RNF14
• Uniprot:
  • Q3ZAU6(Rat)