ARA54 Antibody

Images

 
Western Blot: ARA54 Antibody [NBP1-74097] - Rat Liver lysate, concentration 1 ug/ml.

Product Details

Summary
Product Discontinued
View other related ARA54 Primary Antibodies

Order Details


    • Catalog Number
      NBP1-74097
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

ARA54 Antibody Summary

Immunogen
Synthetic peptides corresponding to the N terminal of Rnf14. Immunizing peptide sequence SAEDLEAQEDELLALASIYDGDEFRKAESVQGGETRIYLDLPQNFKIFVS.
Clonality
Polyclonal
Host
Rabbit
Gene
RNF14
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against Rnf14 and was validated on Western blot.
Theoretical MW
52 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS & 2% Sucrose.
Preservative
No Preservative
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for ARA54 Antibody

  • Androgen receptor-associated protein 54
  • ARA54
  • ARA54androgen receptor associated protein 54
  • EC 6.3.2.-
  • HFB30
  • HFB30E3 ubiquitin-protein ligase RNF14
  • ring finger protein 14FLJ26004
  • RNF14
  • Triad2 protein
  • TRIAD2

Background

The function of this protein remains unknown.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56603
Species: Hu, Pm
Applications: WB, IHC, IHC-P
H00008031-M04
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF
AF5626
Species: Hu
Applications: WB, ICC
NBP2-16468
Species: Hu, Rt
Applications: WB, IHC, IHC-P
NBP1-89146
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB200-310
Species: Hu, Mu, Rt, Mk
Applications: WB, ChIP, IP, IF
NBP1-90117
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-31776
Species: Hu, Mu
Applications: WB, ICC/IF
NB100-1756
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NB100-314
Species: Hu
Applications: WB, IP, PLA
NBP1-90363
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89522
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-381
Species: Hu
Applications: WB, ChIP, IP, PLA
AF2685
Species: Hu
Applications: WB, Simple Western, IHC
NB500-487
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P, IP
NB100-1744
Species: Hu
Applications: IHC-P
H00005956-R02
Species: Hu
NBP1-74097
Species: Rt
Applications: WB

Publications for ARA54 Antibody (NBP1-74097) (0)

There are no publications for ARA54 Antibody (NBP1-74097).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ARA54 Antibody (NBP1-74097) (0)

There are no reviews for ARA54 Antibody (NBP1-74097). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ARA54 Antibody (NBP1-74097) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ARA54 Products

Bioinformatics Tool for ARA54 Antibody (NBP1-74097)

Discover related pathways, diseases and genes to ARA54 Antibody (NBP1-74097). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ARA54 Antibody (NBP1-74097)

Discover more about diseases related to ARA54 Antibody (NBP1-74097).
 

Pathways for ARA54 Antibody (NBP1-74097)

View related products by pathway.

PTMs for ARA54 Antibody (NBP1-74097)

Learn more about PTMs related to ARA54 Antibody (NBP1-74097).

Blogs on ARA54

There are no specific blogs for ARA54, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ARA54 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RNF14
Entrez
Uniprot