Aprataxin Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: Aprataxin Antibody [NBP2-39041] - Immunofluorescent staining of human cell line PC-3 shows localization to nucleus & nucleoli.
Immunohistochemistry: Aprataxin Antibody [NBP2-39041] - Staining of human cerebral cortex shows strong nuclear positivity in neuronal cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Aprataxin Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: HMVNELYPYIVEFEEEAKNPGLETHRKRKRSGNSDSIERDAAQEAEAGTGLEPGSNSGQCSVPLKKGKDAPIKKESLGHWSQGLKISMQDPKMQVYKD
Specificity
Specificity of human Aprataxin antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
APTX
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Aprataxin Antibody

  • AOA1EAOH
  • AOAMGC1072
  • aprataxin
  • ataxia 1, early onset with hypoalbuminemia
  • AXA1
  • EC 3.-
  • EOAHA
  • FHA-HIT
  • FLJ20157
  • Forkhead-associated domain histidine triad-like protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-94712
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP1-87154
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
NB600-41532
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP2-24915
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NB110-61574
Species: Hu, Mu, Bv, Gt, Sh
Applications: WB
NBP2-01743
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-12553
Species: Hu
NB500-418
Species: Hu, Po, Rb
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, RIA, B/N
H00000875-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, RNAi
NBP2-67121
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP1-89061
Species: Hu
Applications: WB, IHC, IHC-P
NB100-56599
Species: Hu, Mu, Rt(-)
Applications: WB, Flow, ICC/IF, Flow-IC
NBP2-14870
Species: Hu, Mu, Rt, Ha
Applications: WB, ICC/IF, IHC, IHC-P
NB110-41404
Species: Hu, Mu, Rt, Bv
Applications: WB, ICC/IF, IHC
NB100-81642
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP1-87257
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, KD
NBP1-87720
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for Aprataxin Antibody (NBP2-39041) (0)

There are no publications for Aprataxin Antibody (NBP2-39041).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Aprataxin Antibody (NBP2-39041) (0)

There are no reviews for Aprataxin Antibody (NBP2-39041). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for Aprataxin Antibody (NBP2-39041) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional Aprataxin Products

Bioinformatics Tool for Aprataxin Antibody (NBP2-39041)

Discover related pathways, diseases and genes to Aprataxin Antibody (NBP2-39041). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Aprataxin Antibody (NBP2-39041)

Discover more about diseases related to Aprataxin Antibody (NBP2-39041).
 

Pathways for Aprataxin Antibody (NBP2-39041)

View related products by pathway.

PTMs for Aprataxin Antibody (NBP2-39041)

Learn more about PTMs related to Aprataxin Antibody (NBP2-39041).
 

Research Areas for Aprataxin Antibody (NBP2-39041)

Find related products by research area.

Blogs on Aprataxin

There are no specific blogs for Aprataxin, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Aprataxin Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol APTX
Uniprot