Apoptosis enhancing nuclease Antibody - BSA Free

Western Blot: Apoptosis enhancing nuclease Antibody [NBP2-87017] - Host: Rabbit. Target Name: AEN. Sample Tissue: Human MCF7 Whole Cell lysates. Antibody Dilution: 1ug/ml

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

Apoptosis enhancing nuclease Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Apoptosis enhancing nuclease Antibody - BSA Free (NBP2-87017) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of human Apoptosis enhancing nuclease. Peptide sequence: REAPESAQCLCPSLTIPNAKDVLRKRHKRRSRQHQRFMARKALLQEQGLL The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: AEN
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for Apoptosis enhancing nuclease Antibody - BSA Free

• apoptosis enhancing nuclease
• EC 3.1
• EC 3.1.13.1
• FLJ12484
• FLJ12562
• interferon stimulated exonuclease gene 20kDa-like 1
• Interferon-stimulated 20 kDa exonuclease-like 1
• ISG20L1apoptosis-enhancing nuclease
• pp12744

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: AEN