Apolipoprotein A5 Antibody - BSA Free Summary
| Description |
Novus Biologicals Rabbit Apolipoprotein A5 Antibody - BSA Free (NBP3-03567) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
Recombinant fusion protein containing a sequence corresponding to amino acids 207-366 of human Apolipoprotein A5 (NP_443200.2). QELHRSVAPHAPASPARLSRCVQVLSRKLTLKAKALHARIQQNLDQLREELSRAFAGTGTEEGAGPDPQMLSEEVRQRLQAFRQDTYLQIAAFTRAIDQETEEVQQQLAPPPPGHSAFAPEFQQTDSGKVLSKLQARLDDLWEDITHSLHDQGHSHLGDP |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
APOA5 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Western Blot 1:500 - 1:1000
|
| Theoretical MW |
41 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.3), 50% glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for Apolipoprotein A5 Antibody - BSA Free
Background
Apolipoprotein A5 (ApoA5) is a minor apolipoprotein, predominantly associated with HDL and and occasionally with VLDL and chylomicrons. ApoA-5 is a useful indicator of plasma triglyceride levels, a major risk factor for coronary artery disease.
Apo A5 is expressed in the plasma and the liver, where it is involved in the early phase of liver regeneration.
APOA5 mutations can lead to increaased susceptibility to familial hypertriglyceridemia (FHTR), a common inherited disorder where VLDL concentrations are elevated in the plasma. This disorder increases the risk of heart disease, obesity, and pancreatitis. APOA5 mutations can also cause hyperlipoproteinemia type 5 (HLPP5), characterized by increased amounts of chylomicrons/VLDL and decreased amounts of LDL/HDL in the plasma. This disorder often leads to a wide array of syndromes, including insulin-dependent diabetes mellitus, contraceptive steroids, alcohol abuse, and glycogen storage disease type 1A
ApoA5 antibodies are useful for studying lipoprotein processing and a variety of cardiac diseases.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P
Species: Hu, Mu
Applications: ICC, IHC, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC, IHC
Species: Hu
Applications: IHC, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Ec, Mu
Applications: CyTOF-ready, Flow-IC, Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Ba, Hu, Pm, Mu, Rt
Applications: DB, ELISA, IB, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
Species: Hu, Mu, Rt(-)
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-P, IP, WB
Species: Bv, Hu, Mu
Applications: ICC, IHC
Species: Bv, Hu, Mu, Rb, Rt
Applications: ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP, KD, Simple Western, WB
Species: Hu
Applications: Simple Western, WB
Species: Hu, Mu, Rt
Applications: ELISA, IHC, WB
Publications for Apolipoprotein A5 Antibody (NBP3-03567) (0)
There are no publications for Apolipoprotein A5 Antibody (NBP3-03567).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Apolipoprotein A5 Antibody (NBP3-03567) (0)
There are no reviews for Apolipoprotein A5 Antibody (NBP3-03567).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Apolipoprotein A5 Antibody (NBP3-03567) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Apolipoprotein A5 Products
Research Areas for Apolipoprotein A5 Antibody (NBP3-03567)
Find related products by research area.
|
Blogs on Apolipoprotein A5