APEX2 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: APEX2 Antibody [NBP2-58257] - Staining of human cell line U-2 OS shows localization to nucleus, nucleoli fibrillar center & vesicles. Antibody staining is shown in green.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

APEX2 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: RLDYVLGDRTLVIDTFQASFLLPEVMGSDHCPVGAVLSVSSVPAKQCPPLCTRFLPEFAGTQLKILRFLVPLEQSPVLEQSTLQHNNQTRVQTCQNKAQVRSTRPQPSQVGSSRG
Specificity
Specificity of human APEX2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
APEX2
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control
APEX2 Knockout 293T Cell Lysate
Control Peptide
APEX2 Recombinant Protein Antigen (NBP2-58257PEP)
Publications
Read Publication using NBP2-58257.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for APEX2 Antibody

  • AP endonuclease 2
  • APE2
  • APEX nuclease (apurinic/apyrimidinic endonuclease) 2
  • APEX nuclease 2
  • APEXL2
  • Apurinic-apyrimidinic endonuclease 2
  • DNA-(apurinic or apyrimidinic site) lyase 2
  • DNA-apurinic or apyrimidinic site lyase 2
  • EC 3.1
  • EC 4.2.99.18
  • XTH2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-116
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ChIP, ELISA, GS, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, ChIP, KD
NB500-106
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
MAB39102
Species: Hu
Applications: ICC
NB600-1031
Species: Hu, Mu, Rt, Rb
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-38600
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-19939
Species: Hu, Mu, Rt
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP
AF2377
Species: Mu
Applications: WB, Simple Western, IHC
NB100-2594
Species: Hu, Mu
Applications: WB, ChIP, IHC, IHC-P, IP
NB100-106
Species: Hu, Mu, Rt, Pm, Rb
Applications: WB, ELISA, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
NBP1-82458
Species: Hu
Applications: IHC, IHC-P
H00004595-M01
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, RNAi, S-ELISA
NB600-922
Species: Ch, V-Vi
Applications: WB, ELISA, IHC, IHC-P, IP
NBP1-57508
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-86274
Species: Hu
Applications: WB, IHC, IHC-P, INHIB T-cell
NBP1-87424
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89276
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for APEX2 Antibody (NBP2-58257)(1)

We have publications tested in 1 confirmed species: Human.


Filter By Application
All Applications
Filter By Species
Human
(1)
All Species

Reviews for APEX2 Antibody (NBP2-58257) (0)

There are no reviews for APEX2 Antibody (NBP2-58257). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for APEX2 Antibody (NBP2-58257) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Control Lysate(s)

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional APEX2 Products

Bioinformatics Tool for APEX2 Antibody (NBP2-58257)

Discover related pathways, diseases and genes to APEX2 Antibody (NBP2-58257). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for APEX2 Antibody (NBP2-58257)

Discover more about diseases related to APEX2 Antibody (NBP2-58257).
 

Pathways for APEX2 Antibody (NBP2-58257)

View related products by pathway.

PTMs for APEX2 Antibody (NBP2-58257)

Learn more about PTMs related to APEX2 Antibody (NBP2-58257).

Blogs on APEX2

There are no specific blogs for APEX2, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our APEX2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol APEX2