APEX2 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: APEX2 Antibody [NBP2-58257] - Staining of human cell line U-2 OS shows localization to nucleus, nucleoli fibrillar center & vesicles. Antibody staining is shown in green.

• Reactivity: Hu
• Applications: ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

APEX2 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: RLDYVLGDRTLVIDTFQASFLLPEVMGSDHCPVGAVLSVSSVPAKQCPPLCTRFLPEFAGTQLKILRFLVPLEQSPVLEQSTLQHNNQTRVQTCQNKAQVRSTRPQPSQVGSSRG
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: APEX2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
• Application Notes: ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  APEX2 Recombinant Protein Antigen (NBP2-58257PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for APEX2 Antibody - BSA Free

• AP endonuclease 2
• APE2
• APEX nuclease (apurinic/apyrimidinic endonuclease) 2
• APEX nuclease 2
• APEXL2
• Apurinic-apyrimidinic endonuclease 2
• DNA-(apurinic or apyrimidinic site) lyase 2
• DNA-apurinic or apyrimidinic site lyase 2
• EC 3.1
• EC 4.2.99.18
• XTH2

Background

Apurinic/apyrimidinic (AP) sites occur frequently in DNA molecules by spontaneous hydrolysis, by DNA damaging agents or by DNA glycosylases that remove specific abnormal bases. AP sites are pre-mutagenic lesions that can prevent normal DNA replication so the cell contains systems to identify and repair such sites. Class II AP endonucleases cleave the phosphodiester backbone 5' to the AP site. This gene encodes a protein shown to have a weak class II AP endonuclease activity. Most of the encoded protein is located in the nucleus but some is also present in mitochondria. This protein may play an important role in both nuclear and mitochondrial base excision repair (BER). [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for APEX2 Antibody (NBP2-58257)(1)

Publication using NBP2-58257

• Mengwasser KE, Adeyemi RO, Leng Y et al. Genetic Screens Reveal FEN1 and APEX2 as BRCA2 Synthetic Lethal Targets. Mol. Cell 2019-01-23 [PMID: 30686591] (Human)

Bioinformatics

• Gene Symbol: APEX2