Apelin Antibody (2B6)


There are currently no images for Apelin Antibody (H00008862-M04).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Reactivity HuSpecies Glossary
Applications ELISA

Order Details

Apelin Antibody (2B6) Summary

APLN (AAH21104, 1 a.a. - 77 a.a.) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MNLRLCVQALLLLWLSLTAVCGGSLMPLPDGNGLEDGNVRHLVQPRGSRNGPGPWQGGRRKFRRQRPRLSHKGPMPF
APLN - apelin, AGTRL1 ligand (2B6)
IgG2a Kappa
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


Application Notes
It has been used for ELISA.

Packaging, Storage & Formulations

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
PBS (pH 7.4)
No Preservative
IgG purified


Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Apelin Antibody (2B6)

  • AGTRL1 ligand
  • AGTRL1 Lligand
  • APEL
  • Apelin
  • apelin, AGTRL1 ligand
  • APJ endogenous ligand
  • APLN
  • XNPEP2


Apelin is a neuropeptide expressed in the supraoptic and paraventricular nuclei that acts on specific receptors located on vasopressinergic neurons (De Mota et al., 2004) [PubMed 15231996].[supplied by OMIM]


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
Species: Hu, Mu, Rt, Ma
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: IHC
Species: Hu, Mu, Rt, Po, Am, Bv, Ca, Dr
Applications: WB, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
Species: Hu
Applications: ELISA

Publications for Apelin Antibody (H00008862-M04) (0)

There are no publications for Apelin Antibody (H00008862-M04).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Apelin Antibody (H00008862-M04) (0)

There are no reviews for Apelin Antibody (H00008862-M04). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Apelin Antibody (H00008862-M04) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Apelin Products

Bioinformatics Tool for Apelin Antibody (H00008862-M04)

Discover related pathways, diseases and genes to Apelin Antibody (H00008862-M04). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Apelin Antibody (H00008862-M04)

Discover more about diseases related to Apelin Antibody (H00008862-M04).

Pathways for Apelin Antibody (H00008862-M04)

View related products by pathway.

PTMs for Apelin Antibody (H00008862-M04)

Learn more about PTMs related to Apelin Antibody (H00008862-M04).

Blogs on Apelin

There are no specific blogs for Apelin, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Apelin Antibody (2B6) and receive a gift card or discount.


Gene Symbol APLN