Reactivity | Hu, MuSpecies Glossary |
Applications | WB, ICC/IF, IHC, IHC-P |
Clonality | Polyclonal |
Host | Rabbit |
Conjugate | Unconjugated |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: IDQDLMVAQFSTPSLPPTLKVGFLPSAGKEQSVLWVSLEEAEPIPDIHWGIRVLQPPPEQENVQYAGLDFEAILLQPGSPPDKTQVP |
Isotype | IgG |
Clonality | Polyclonal |
Host | Rabbit |
Gene | APEH |
Purity | Immunogen affinity purified |
Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
Dilutions |
|
||
Application Notes | IHC reported in scientific literature (PMID: 24554718). For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100. |
||
Control Peptide |
|
||
Publications |
|
Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer | PBS (pH 7.2) and 40% Glycerol |
Preservative | 0.02% Sodium Azide |
Purity | Immunogen affinity purified |
Publication using NBP1-85333 | Applications | Species |
---|---|---|
Santhoshkumar P, Xie L, Raju M et al. Lens Crystallin Modifications and Cataract in Transgenic Mice Overexpressing Acylpeptide Hydrolase. J Biol Chem 2014-03-28 [PMID: 24554718] (IHC, Mouse) | IHC | Mouse |
Secondary Antibodies |
Isotype Controls |
Diseases for APEH Antibody (NBP1-85333)Discover more about diseases related to APEH Antibody (NBP1-85333).
|
PTMs for APEH Antibody (NBP1-85333)Learn more about PTMs related to APEH Antibody (NBP1-85333).
| Research Areas for APEH Antibody (NBP1-85333)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
Gene Symbol | APEH |