APEH Antibody - BSA Free

Immunohistochemistry-Paraffin: APEH Antibody [NBP1-85332] - Staining in human kidney and pancreas tissues using anti-APEH antibody. Corresponding APEH RNA-seq data are presented for the same tissues.

Western Blot: APEH Antibody [NBP1-85332] - Analysis using Anti-APEH antibody NBP1-85332 (A) shows similar pattern to independent antibody NBP1-85333 (B).

Immunocytochemistry/Immunofluorescence: APEH Antibody [NBP1-85332] - Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol.

Immunohistochemistry-Paraffin: APEH Antibody [NBP1-85332] - Staining of human cerebral cortex.

Western Blot: APEH Antibody [NBP1-85332] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).

Immunohistochemistry-Paraffin: APEH Antibody [NBP1-85332] - Staining of human pancreas.

Immunohistochemistry-Paraffin: APEH Antibody [NBP1-85332] - Staining of human colon.

Immunohistochemistry-Paraffin: APEH Antibody [NBP1-85332] - Staining of human kidney.

• Reactivity: Hu, Rt, Mu
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

APEH Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: RQYLVFHDGDSVVFAGPAGNSVETRGELLSRESPSGTMKAVLRKAGGTGPGEEKQFLEVWEKNRKLKSFNLSALEKHGPVYEDDCFGC
• Predicted Species: Mouse (97%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: APEH
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF,Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  APEH Protein (NBP1-85332PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for APEH Antibody - BSA Free

• AARE
• ACPH
• acylamino-acid-releasing enzyme
• acylaminoacyl-peptidase
• Acyl-peptide hydrolase
• APH
• D3F15S2
• D3S48EEC 3.4.19.1
• DNF15S2
• MGC2178
• N-acylaminoacyl-peptide hydrolase
• OPH
• Oxidized protein hydrolase

Background

The APEH gene encodes the enzyme acylpeptide hydrolase, which catalyzes the hydrolysis of the terminal acetylated aminoacid preferentially from small acetylated peptides. The acetyl amino acid formed by this hydrolase is furtherprocessed to acetate and a free

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: APEH