Recombinant Human APAF-1 Protein

Images

 
SDS-Page: Recombinant Human APAF-1 Protein [H00000317-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human APAF-1 Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1-100 of Human APAF1 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:GEIRIWNVSNGELLHLCAPLSEEGAATHGGWVTDLCFSPDGKMLISAGGYIKWWNVVTGESSQTFYTNGTNLKKIHVSPDFKTYVTVDNLGILYILQTLE

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
APAF1

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human APAF-1 Protein

  • APAF1
  • APAF-1
  • APAF-1apoptotic protease activating factor 1
  • apoptotic peptidase activating factor 1
  • apoptotic peptidase activating factor
  • apoptotic protease activating factor
  • apoptotic protease-activating factor 1
  • CED4
  • DKFZp781B1145
  • KIAA0413

Background

APAF1 - apoptotic protease activating factor

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56118
Species: Hu, Mu, Rt, Ca, Ge
Applications: IHC, IHC-Fr, IHC-P, IP, Flow-IC
NB100-56503
Species: Hu, Mu, Rt, Po, Ca, Dr, Eq, Ma, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-56708
Species: Hu, Mu, Rt, Po, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready
NB100-56098
Species: Hu, Mu, Ca
Applications: WB, IHC, IHC-P, IP
NB100-56104
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P, IP
NBP1-28566
Species: Hu, Mu, Rt, Bv, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IP
NB100-56116
Species: Hu, Mu, Rt, Ge
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
AF8221
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
NB500-218
Species: Hu, Mu
Applications: WB
NB100-56311
Species: Hu
Applications: WB, ICC/IF, IHC-P
NB120-13550
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56106
Species: Hu, Mu, Rt, Ca, Ge
Applications: WB, IHC, IHC-Fr, IHC-P, IP
AF1457
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC
NBP2-27335
Species: Hu
Applications: WB, Flow, CyTOF-ready
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
H00000317-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for APAF-1 Partial Recombinant Protein (H00000317-Q01) (0)

There are no publications for APAF-1 Partial Recombinant Protein (H00000317-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for APAF-1 Partial Recombinant Protein (H00000317-Q01) (0)

There are no reviews for APAF-1 Partial Recombinant Protein (H00000317-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for APAF-1 Partial Recombinant Protein (H00000317-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional APAF-1 Products

Bioinformatics Tool for APAF-1 Partial Recombinant Protein (H00000317-Q01)

Discover related pathways, diseases and genes to APAF-1 Partial Recombinant Protein (H00000317-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for APAF-1 Partial Recombinant Protein (H00000317-Q01)

Discover more about diseases related to APAF-1 Partial Recombinant Protein (H00000317-Q01).
 

Pathways for APAF-1 Partial Recombinant Protein (H00000317-Q01)

View related products by pathway.

PTMs for APAF-1 Partial Recombinant Protein (H00000317-Q01)

Learn more about PTMs related to APAF-1 Partial Recombinant Protein (H00000317-Q01).
 

Research Areas for APAF-1 Partial Recombinant Protein (H00000317-Q01)

Find related products by research area.

Blogs on APAF-1.

Caspase 9 - an important apoptosis marker
Caspases are essential mediators of programmed cell death and are needed for both the induction of apoptosis as well as for aiding the degradation of cellular structures. Initiator caspases (such as Caspase-9) sense and respond to various signals i...  Read full blog post.

Heat Shock Proteins: An Overview
Heat Shock Proteins (HSPs) are a ubiquitous group of molecular chaperone proteins that have evolved unique mechanisms, within their host cells, to facilitate survival in hostile environments such as heat, oxidative (hypoxia), pH and cold. Under permis...  Read full blog post.

The Role of the Caspase 3 Antibody in Apoptosis Research
The caspases are a group of cysteine protease enzymes essential to apoptosis, inflammation and necrosis. Caspase 3 has been identified as one of the key mediators of apoptosis.Human caspases form three distinct groups: cytokine activators, which are...  Read full blog post.

Customers Who Bought This Also Bought

APAF-1 Antibody
NB100-56074

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human APAF-1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol APAF1
Entrez