Annexin A4 Antibody


Western Blot: Annexin A4 Antibody [NBP1-59120] - Sample Tissue: Human Fetal Liver Antibody Dilution: 1.0 ug/ml
Immunohistochemistry: Annexin A4 Antibody [NBP1-59120] - Human Intestine
Western Blot: Annexin A4 Antibody [NBP1-59120] - Titration: 1.25ug/ml, Positive Control: Human Placenta.

Product Details

Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P

Order Details

Annexin A4 Antibody Summary

Synthetic peptides corresponding to ANXA4 (annexin A4) The peptide sequence was selected from the N terminal of ANXA4. Peptide sequence GLGTDEDAIISVLAYRNTAQRQEIRTAYKSTIGRDLIDDLKSELSGNFEQ.
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Protein A purified


  • Western Blot 1:100-1:2000
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
Read Publication using
NBP1-59120 in the following applications:

  • WB
    1 publication


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Annexin A4 Antibody

  • AIV
  • Annexin A4
  • annexin IV (placental anticoagulant protein II)
  • Annexin IV
  • annexin-4
  • ANX4
  • ANX4Carbohydrate-binding protein p33/p41
  • ANXA4
  • Chromobindin-4
  • chromobindin-4,35-beta calcimedin
  • DKFZp686H02120
  • Endonexin I
  • Lipocortin IV
  • MGC75105
  • P32.5
  • PAP-II
  • PIG28
  • Placental anticoagulant protein II
  • PP4-X
  • proliferation-inducing gene 28
  • proliferation-inducing protein 28
  • Protein II
  • ZAP36


Annexin A4 (ANXA4) belongs to the annexin family of calcium-dependent phospholipid binding proteins. Although their functions are still not clearly defined, several members of the annexin family have been implicated in membrane-related events along exocytotic and endocytotic pathways. ANXA4 has 45 to 59% identity with other members of its family and shares a similar size and exon-intron organization. Isolated from human placenta, ANXA4 encodes a protein that has possible interactions with ATP, and has in vitro anticoagulant activity and also inhibits phospholipase A2 activity. ANXA4 is almost exclusively expressed in epithelial cells.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Bv, Ca, Pm
Applications: WB, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt, Op, Pm
Applications: WB
Species: Hu, Pm
Applications: WB, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P

Publications for Annexin A4 Antibody (NBP1-59120)(1)

We have publications tested in 1 confirmed species: Porcine.

We have publications tested in 1 application: WB.

Filter By Application
All Applications
Filter By Species
All Species

Reviews for Annexin A4 Antibody (NBP1-59120) (0)

There are no reviews for Annexin A4 Antibody (NBP1-59120). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Annexin A4 Antibody (NBP1-59120) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Annexin A4 Antibody Products

Related Products by Gene

Bioinformatics Tool for Annexin A4 Antibody (NBP1-59120)

Discover related pathways, diseases and genes to Annexin A4 Antibody (NBP1-59120). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Annexin A4 Antibody (NBP1-59120)

Discover more about diseases related to Annexin A4 Antibody (NBP1-59120).

Pathways for Annexin A4 Antibody (NBP1-59120)

View related products by pathway.

PTMs for Annexin A4 Antibody (NBP1-59120)

Learn more about PTMs related to Annexin A4 Antibody (NBP1-59120).

Research Areas for Annexin A4 Antibody (NBP1-59120)

Find related products by research area.

Blogs on Annexin A4

There are no specific blogs for Annexin A4, but you can read our latest blog posts.

Contact Information

Product PDFs

Review this Product

Be the first to review our Annexin A4 Antibody and receive a gift card or discount.


Gene Symbol ANXA4

Customers Who Bought This Also Bought

Annexin V Apoptosis Kit [FITC]
Annexin V Apoptosis Kit [FITC]
Annexin V Apoptosis Kit [FITC]