Annexin A4 Antibody

Images

 
Western Blot: Annexin A4 Antibody [NBP1-59120] - Sample Tissue: Human Fetal Liver Antibody Dilution: 1.0 ug/ml
Immunohistochemistry: Annexin A4 Antibody [NBP1-59120] - Human Intestine
Western Blot: Annexin A4 Antibody [NBP1-59120] - Titration: 1.25ug/ml, Positive Control: Human Placenta.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit

Order Details

Annexin A4 Antibody Summary

Immunogen
Synthetic peptides corresponding to ANXA4 (annexin A4) The peptide sequence was selected from the N terminal of ANXA4. Peptide sequence GLGTDEDAIISVLAYRNTAQRQEIRTAYKSTIGRDLIDDLKSELSGNFEQ.
Clonality
Polyclonal
Host
Rabbit
Gene
ANXA4
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Conjugate
Unconjugated
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Protein A purified

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
Publications
Read Publication using
NBP1-59120 in the following applications:

  • WB
    1 publication

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Annexin A4 Antibody

  • AIV
  • Annexin A4
  • annexin IV (placental anticoagulant protein II)
  • Annexin IV
  • annexin-4
  • ANX4
  • ANX4Carbohydrate-binding protein p33/p41
  • ANXA4
  • Chromobindin-4
  • chromobindin-4,35-beta calcimedin
  • DKFZp686H02120
  • Endonexin I
  • Lipocortin IV
  • MGC75105
  • P32.5
  • PAP-II
  • PIG28
  • Placental anticoagulant protein II
  • PP4-X
  • proliferation-inducing gene 28
  • proliferation-inducing protein 28
  • Protein II
  • ZAP36

Background

Annexin A4 (ANXA4) belongs to the annexin family of calcium-dependent phospholipid binding proteins. Although their functions are still not clearly defined, several members of the annexin family have been implicated in membrane-related events along exocytotic and endocytotic pathways. ANXA4 has 45 to 59% identity with other members of its family and shares a similar size and exon-intron organization. Isolated from human placenta, ANXA4 encodes a protein that has possible interactions with ATP, and has in vitro anticoagulant activity and also inhibits phospholipase A2 activity. ANXA4 is almost exclusively expressed in epithelial cells.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB3928
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
NBP1-90149
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-23485
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, IHC, IHC-P
NBP1-85464
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-31442
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24593
Species: Hu, Mu, Rt, Bv, Ca, Pm
Applications: WB, IHC-P
NBP2-32569
Species: Hu
Applications: IHC, IHC-P
NBP1-90155
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-38124
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-2590
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB6240
Species: Hu
Applications: WB, IHC
NBP1-87345
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87343
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-24614
Species: Hu, Mu, Rt, Op, Pm
Applications: WB
NBP2-24763
Species: Hu, Pm
Applications: WB, IHC-P
NBP1-59120
Species: Hu
Applications: WB, IHC, IHC-P

Publications for Annexin A4 Antibody (NBP1-59120)(1)

We have publications tested in 1 confirmed species: Porcine.

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
Porcine
(1)
All Species

Reviews for Annexin A4 Antibody (NBP1-59120) (0)

There are no reviews for Annexin A4 Antibody (NBP1-59120). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Annexin A4 Antibody (NBP1-59120) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Annexin A4 Antibody Products

Related Products by Gene

Bioinformatics Tool for Annexin A4 Antibody (NBP1-59120)

Discover related pathways, diseases and genes to Annexin A4 Antibody (NBP1-59120). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Annexin A4 Antibody (NBP1-59120)

Discover more about diseases related to Annexin A4 Antibody (NBP1-59120).
 

Pathways for Annexin A4 Antibody (NBP1-59120)

View related products by pathway.

PTMs for Annexin A4 Antibody (NBP1-59120)

Learn more about PTMs related to Annexin A4 Antibody (NBP1-59120).
 

Research Areas for Annexin A4 Antibody (NBP1-59120)

Find related products by research area.

Blogs on Annexin A4

There are no specific blogs for Annexin A4, but you can read our latest blog posts.

Contact Information

Product PDFs

Bioinformatics

Gene Symbol ANXA4
Entrez
Uniprot

Customer Resources

Novus Review - Submit your review and earn rewards points which can be used for merchandise & discounts.
Risk Free Testing - Test on a species/application not listed above to receive a full credit towards a future purchase.

Novus' Quality Guarantee - Novus guarantees that every product we sell will work in the application and species listed on our website and datasheets.

Submit your question on NBP1-59120 below.
During business hours, we will respond to your email within 24 hours. For any questions submitted on the weekend, a response will be received on Monday.
For immediate assistance during business hours M- F (excluding major holidays), please contact us.
Ask a Scientist - We have a lab full of white coats just waiting for your scientific questions and concerns.

Customers Who Bought This Also Bought

Annexin V Apoptosis Kit [FITC]
NBP2-29373-100Tests
Annexin V Apoptosis Kit [FITC]
NBP2-29373-100Tests
Annexin V Apoptosis Kit [FITC]
NBP2-29373-100Tests