Annexin A4 Antibody

Images

 
Western Blot: Annexin A4 Antibody [H00000307-D01P] - Analysis of ANXA4 expression in mouse intestine.
Western Blot: Annexin A4 Antibody [H00000307-D01P] - Analysis of ANXA4 expression in PC-12.
Western Blot: Annexin A4 Antibody [H00000307-D01P] - Analysis of ANXA4 expression in Raw 264.7.
Western Blot: Annexin A4 Antibody [H00000307-D01P] - Analysis of ANXA4 expression in A-431.
Western Blot: Annexin A4 Antibody [H00000307-D01P] - Analysis of ANXA4 expression in K-562.
Western Blot: Annexin A4 Antibody [H00000307-D01P] - Analysis of ANXA4 expression in human stomach.
Western Blot: Annexin A4 Antibody [H00000307-D01P] - Analysis of ANXA4 expression in mouse brain.
Western Blot: Annexin A4 Antibody [H00000307-D01P] - Analysis of ANXA4 expression in rat brain.
Western Blot: Annexin A4 Antibody [H00000307-D01P] - Analysis of ANXA4 expression in transfected 293T cell line by ANXA4 polyclonal antibody.Lane 1: ANXA4 transfected lysate(36.10 KDa).Lane 2: Non-transfected lysate.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Annexin A4 Antibody Summary

Immunogen
ANXA4 (NP_001144.1, 1 a.a. - 321 a.a.) full-length human protein. MAMATKGGTVKAASGFNAMEDAQTLRKAMKGLGTDEDAIISVLAYRNTAQRQEIRTAYKSTIGRDLIDDLKSELSGNFEQVIVGMMTPTVLYDVQELRRAMKGAGTDEGCLIEILASRTPEEIRRISQTYQQQYGRSLEDDIRSDTSFMFQRVLVSLSAGGRDEGNYLDDALVRQDAQDLYEAGEKKWGTDEVKFLTVLCSRNRNHLLHVFDEYKRISQKDIEQSIKSETSGSFEDALLAIVKCMRNKSAYFAEKLYKSMKGLGTDDNTLIRVMVSRAEIDMLDIRAHFKRLYGKSLYSFIKGDTSGDYRKVLLVLCGGDD
Specificity
ANXA4 - annexin A4,
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ANXA4
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Annexin A4 Antibody

  • AIV
  • Annexin A4
  • annexin IV (placental anticoagulant protein II)
  • Annexin IV
  • annexin-4
  • ANX4
  • ANX4Carbohydrate-binding protein p33/p41
  • ANXA4
  • Chromobindin-4
  • chromobindin-4,35-beta calcimedin
  • DKFZp686H02120
  • Endonexin I
  • Lipocortin IV
  • MGC75105
  • P32.5
  • PAP-II
  • PIG28
  • Placental anticoagulant protein II
  • PP4-X
  • proliferation-inducing gene 28
  • proliferation-inducing protein 28
  • Protein II
  • ZAP36

Background

Annexin IV (ANX4) belongs to the annexin family of calcium-dependent phospholipid binding proteins. Although their functions are still not clearly defined, several members of the annexin family have been implicated in membrane-related events along exocytotic and endocytotic pathways. ANX4 has 45 to 59% identity with other members of its family and shares a similar size and exon-intron organization. Isolated from human placenta, ANX4 encodes a protein that has possible interactions with ATP, and has in vitro anticoagulant activity and also inhibits phospholipase A2 activity. ANX4 is almost exclusively expressed in epithelial cells. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-31310
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-52414
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, CyTOF-ready, ICC, IF
NBP1-90149
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
AF3770
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
NBP1-85464
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF3926
Species: Hu, Mu, Rt
Applications: WB
MAB2669
Species: Hu
Applications: WB, Simple Western, IHC
MAB5018
Species: Hu
Applications: WB, IP
NBP1-90155
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85525
Species: Hu
Applications: WB, IHC, IHC-P
NB100-2590
Species: Hu
Applications: IP (-), WB, IHC-P
MAB6240
Species: Hu
Applications: WB, IHC
NB100-55268
Species: Hu
Applications: WB, IP
NBP1-87343
Species: Hu, Rt
Applications: WB, IHC, IHC-P
NBP2-24614
Species: Hu, Mu, Rt, Op, Pm
Applications: WB
NBP2-24763
Species: Hu, Pm
Applications: WB, IHC-P

Publications for Annexin A4 Antibody (H00000307-D01P) (0)

There are no publications for Annexin A4 Antibody (H00000307-D01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Annexin A4 Antibody (H00000307-D01P) (0)

There are no reviews for Annexin A4 Antibody (H00000307-D01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Annexin A4 Antibody (H00000307-D01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Annexin A4 Products

Bioinformatics Tool for Annexin A4 Antibody (H00000307-D01P)

Discover related pathways, diseases and genes to Annexin A4 Antibody (H00000307-D01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Annexin A4 Antibody (H00000307-D01P)

Discover more about diseases related to Annexin A4 Antibody (H00000307-D01P).
 

Pathways for Annexin A4 Antibody (H00000307-D01P)

View related products by pathway.

PTMs for Annexin A4 Antibody (H00000307-D01P)

Learn more about PTMs related to Annexin A4 Antibody (H00000307-D01P).
 

Research Areas for Annexin A4 Antibody (H00000307-D01P)

Find related products by research area.

Blogs on Annexin A4

There are no specific blogs for Annexin A4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Annexin A4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ANXA4
Entrez
Uniprot