Annexin A4 Antibody - Azide and BSA Free

Western Blot: Annexin A4 Antibody [H00000307-D01P] - Analysis of ANXA4 expression in mouse intestine.

Western Blot: Annexin A4 Antibody [H00000307-D01P] - Analysis of ANXA4 expression in PC-12.

Western Blot: Annexin A4 Antibody [H00000307-D01P] - Analysis of ANXA4 expression in Raw 264.7.

Western Blot: Annexin A4 Antibody [H00000307-D01P] - Analysis of ANXA4 expression in A-431.

Western Blot: Annexin A4 Antibody [H00000307-D01P] - Analysis of ANXA4 expression in K-562.

Western Blot: Annexin A4 Antibody [H00000307-D01P] - Analysis of ANXA4 expression in human stomach.

Western Blot: Annexin A4 Antibody [H00000307-D01P] - Analysis of ANXA4 expression in mouse brain.

Western Blot: Annexin A4 Antibody [H00000307-D01P] - Analysis of ANXA4 expression in rat brain.

Western Blot: Annexin A4 Antibody [H00000307-D01P] - Analysis of ANXA4 expression in transfected 293T cell line by ANXA4 polyclonal antibody.Lane 1: ANXA4 transfected lysate(36.10 KDa).Lane 2: Non-transfected lysate.

• Reactivity: Hu, Mu, Rt
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: Azide and BSA Free

Annexin A4 Antibody - Azide and BSA Free Summary

• Description: Quality control test: Antibody reactive against mammalian transfected lysate.
• Immunogen: ANXA4 (NP_001144.1, 1 a.a. - 321 a.a.) full-length human protein. MAMATKGGTVKAASGFNAMEDAQTLRKAMKGLGTDEDAIISVLAYRNTAQRQEIRTAYKSTIGRDLIDDLKSELSGNFEQVIVGMMTPTVLYDVQELRRAMKGAGTDEGCLIEILASRTPEEIRRISQTYQQQYGRSLEDDIRSDTSFMFQRVLVSLSAGGRDEGNYLDDALVRQDAQDLYEAGEKKWGTDEVKFLTVLCSRNRNHLLHVFDEYKRISQKDIEQSIKSETSGSFEDALLAIVKCMRNKSAYFAEKLYKSMKGLGTDDNTLIRVMVSRAEIDMLDIRAHFKRLYGKSLYSFIKGDTSGDYRKVLLVLCGGDD
• Specificity: ANXA4 - annexin A4,
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ANXA4
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Western Blot
• Application Notes: Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.4)
• Preservative: No Preservative
• Purity: Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Annexin A4 Antibody - Azide and BSA Free

• AIV
• Annexin A4
• annexin IV (placental anticoagulant protein II)
• Annexin IV
• annexin-4
• ANX4
• ANX4Carbohydrate-binding protein p33/p41
• ANXA4
• Chromobindin-4
• chromobindin-4,35-beta calcimedin
• DKFZp686H02120
• Endonexin I
• Lipocortin IV
• MGC75105
• P32.5
• PAP-II
• PIG28
• Placental anticoagulant protein II
• PP4-X
• proliferation-inducing gene 28
• proliferation-inducing protein 28
• Protein II
• ZAP36

Background

Annexin IV (ANX4) belongs to the annexin family of calcium-dependent phospholipid binding proteins. Although their functions are still not clearly defined, several members of the annexin family have been implicated in membrane-related events along exocytotic and endocytotic pathways. ANX4 has 45 to 59% identity with other members of its family and shares a similar size and exon-intron organization. Isolated from human placenta, ANX4 encodes a protein that has possible interactions with ATP, and has in vitro anticoagulant activity and also inhibits phospholipase A2 activity. ANX4 is almost exclusively expressed in epithelial cells. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ANXA4
• Entrez:
  • 307(Human)
• Uniprot:
  • NP_001144.1(Human)