Annexin A4 Antibody (8T6E6)

Western Blot: Annexin A4 Antibody (8T6E6) [NBP3-16785] - Western blot analysis of extracts of various cell lines, using Annexin A4/Annexin A4 Rabbit mAb (NBP3-16785) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Enhanced Kit. Exposure time: 3min.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF
• Clone: 8T6E6
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

Annexin A4 Antibody (8T6E6) Summary

• Description: Novus Biologicals Rabbit Annexin A4 Antibody (8T6E6) (NBP3-16785) is a recombinant monoclonal antibody validated for use in WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Additional Information: Recombinant Monoclonal Antibody
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Annexin A4 (P09525). MATKGGTVKAASGFNAMEDAQTLRKAMKGLGTDEDAIISVLAYRNTAQRQEIRTAYKSTIGRDLIDDLKSELSGNFEQVIVGMMTPTVLYDVQELRRAMK
• Source: HEK293
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: ANXA4
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
  • Western Blot 1:500 - 1:1000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Annexin A4 Antibody (8T6E6)

• AIV
• Annexin A4
• annexin IV (placental anticoagulant protein II)
• Annexin IV
• annexin-4
• ANX4
• ANX4Carbohydrate-binding protein p33/p41
• ANXA4
• Chromobindin-4
• chromobindin-4,35-beta calcimedin
• DKFZp686H02120
• Endonexin I
• Lipocortin IV
• MGC75105
• P32.5
• PAP-II
• PIG28
• Placental anticoagulant protein II
• PP4-X
• proliferation-inducing gene 28
• proliferation-inducing protein 28
• Protein II
• ZAP36

Background

Annexin A4, also known as Annexin A4, belongs to the annexin family of calcium dependent phospholipid binding proteins. Annexin A4 is almost exclusively expressed in epithelial cells.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ANXA4