Annexin A13 Antibody - BSA Free

Immunohistochemistry-Paraffin: Annexin A13 Antibody [NBP1-90158] - Staining of human duodenum, fallopian tube, gallbladder and small intestine using Anti-ANXA13 antibody NBP1-90158 (A) shows similar protein distribution across tissues to independent antibody NBP1-90159 (B).

Immunohistochemistry-Paraffin: Annexin A13 Antibody [NBP1-90158] - Staining in human duodenum and pancreas tissues using anti-ANXA13 antibody. Corresponding ANXA13 RNA-seq data are presented for the same tissues.

Staining of human duodenum shows high expression.

Staining of human pancreas shows low expression as expected.

Immunohistochemistry-Paraffin: Annexin A13 Antibody [NBP1-90158] - Staining of human fallopian tube.

Immunohistochemistry-Paraffin: Annexin A13 Antibody [NBP1-90158] - Staining of human small intestine.

Immunohistochemistry-Paraffin: Annexin A13 Antibody [NBP1-90158] - Staining of human gallbladder.

Immunohistochemistry-Paraffin: Annexin A13 Antibody [NBP1-90158] - Staining of human duodenum using Anti-ANXA13 antibody NBP1-90158.

Western Blot: Annexin A13 Antibody [NBP1-90158] - Analysis using Anti-ANXA13 antibody NBP1-90158 (A) shows similar pattern to independent antibody NBP1-90157 (B).

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Annexin A13 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: RHSQSYTLSEGSQQLPKGDSQPSTVVQPLSHPSRNGEPEAPQPAKASSPQGFDVDRDAKKLNKACKGMGTN
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ANXA13
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  Annexin A13 Protein (NBP1-90158PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Annexin A13 Antibody - BSA Free

• Annexin A13
• Annexin XIII
• Annexin-13
• ANX13
• ANX13annexin, intestine-specific
• ANXA13
• Intestine-specific annexin
• ISA
• ISAannexin-13
• MGC150460

Background

Annexin A13 encodes a member of the annexin family. Members of this calcium-dependent phospholipid-binding protein family play a role in the regulation of cellular growth and in signal transduction pathways. The specific function of this gene has not yet been determined; however, it is associated with the plasma membrane of undifferentiated, proliferating endothelial cells and differentiated villus enterocytes. Alternatively spliced transcript variants encoding different isoforms have been identified.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ANXA13