Annexin A10 Antibody - BSA Free

Immunohistochemistry-Paraffin: Annexin A10 Antibody [NBP1-90156] - Staining in human stomach and tonsil tissues . Corresponding ANXA10 RNA-seq data are presented for the same tissues.

Western Blot: Annexin A10 Antibody [NBP1-90156] - Analysis in human stomach tissue.

Immunohistochemistry-Paraffin: Annexin A10 Antibody [NBP1-90156] - Staining of human urinary bladder shows moderate nuclear positivity in urothelial cells.

Immunohistochemistry-Paraffin: Annexin A10 Antibody [NBP1-90156] - Staining of human stomach shows moderate to strong nuclear positivity in glandular cells.

Immunohistochemistry-Paraffin: Annexin A10 Antibody [NBP1-90156] - Staining of human tonsil shows no positivity as expected.

Simple Western: Annexin A10 Antibody [NBP1-90156] - Simple Western lane view shows a specific band for ANXA10 in 0.2 mg/ml of U-251MG sp lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.

Simple Western: Annexin A10 Antibody [NBP1-90156] - Electropherogram image(s) of corresponding Simple Western lane view. Annexin A10 antibody was used at 1:20 dilution on RT-4 and U-251MG lysate(s).

Immunohistochemistry: Annexin A10 Antibody [NBP1-90156] - Histological & immunohistochemical staining of type A2 TSAs. a HE staining. b A high-power view showing the TSA component (red box in Fig. 2a). c A high-power view showing the precursor component (blue box in Fig. 2a). d Positive for annexin A10 expression. e Positive for MUC2 expression. f Positive for MUC5AC expression. g Negative for MUC6 expression. h Negative for CD10 expression. i Positive for annexin A10 expression. j Positive for MUC2 expression. k Positive for MUC5AC expression. l Negative for MUC6 expression. m Negative for CD10 expression Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/32535664), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

Immunohistochemistry: Annexin A10 Antibody [NBP1-90156] - Histological & immunohistochemical staining of type A2 TSAs. a HE staining. b A high-power view showing the TSA component (red box in Fig. 2a). c A high-power view showing the precursor component (blue box in Fig. 2a). d Positive for annexin A10 expression. e Positive for MUC2 expression. f Positive for MUC5AC expression. g Negative for MUC6 expression. h Negative for CD10 expression. i Positive for annexin A10 expression. j Positive for MUC2 expression. k Positive for MUC5AC expression. l Negative for MUC6 expression. m Negative for CD10 expression Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/32535664), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

Immunohistochemistry: Annexin A10 Antibody [NBP1-90156] - Histological & immunohistochemical staining of type A1 TSAs. a HE staining. b A high-power view showing the TSA component (red box in Fig. 1a). c A high-power view showing the precursor component (blue box in Fig. 1a). d Positive for annexin A10 expression. e Positive for MUC2 expression. f Partially positive for MUC5AC expression. g Negative for MUC6 expression. h Negative for CD10 expression. i Negative for annexin A10 expression. j Positive for MUC2 expression. k Positive for MUC5AC expression. l Negative for MUC6 expression. m Negative for CD10 expression Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/32535664), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

• Reactivity: Hu, Mu, Rt
• Applications: WB, Simple Western, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Annexin A10 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: PPLYDAHELWHAMKGVGTDENCLIEILASRTNGEIFQMREAYCLQYSNNLQEDIYSETSGHFRDTLMNLVQGTREEGYTDPAMAAQDAMVLWEACQQKTGEHKTMLQMILCNK
• Predicted Species: Mouse (95%), Rat (97%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ANXA10
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
  • Simple Western 1:20
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
  
  In Simple Western only 10 - 15 uL of the recommended dilution is used per data point.
  See Simple Western Antibody Database for Simple Western validation: Tested in U-251MG sp, separated by Size, antibody dilution of 1:20, apparent MW was 43 kDa. Separated by Size-Wes, Sally Sue/Peggy Sue.
• Theoretical MW: 37 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
• Control Peptide:

  Annexin A10 Protein (NBP1-90156PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Annexin A10 Antibody - BSA Free

• annexin 14
• Annexin A10
• annexin-10
• annexin-14
• ANX14
• ANX14Annexin-10
• ANXA10

Background

Annexin A10 encodes a member of the annexin family. Members of this calcium-dependent phospholipid-binding protein family play a role in the regulation of cellular growth and in signal transduction pathways. The function of this gene has not yet been determined.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Annexin A10 Antibody (NBP1-90156)(26)

Publications using NBP1-90156

• Herrera-López EE, Guerrero-Escalera D, Aguirre-Maldonado I et al. Annexins A2 and A5 are potential early biomarkers of hepatocarcinogenesis Scientific reports 2023-04-28 [PMID: 37117324]
• Isidro R, Abukhiran I, Dunseth C et al. Strong Annexin A10 Expression Supports a Pancreatic Primary and Combined Annexin A10, Claudin 18, and SOX2 Expression Supports an Esophagogastric Origin in Carcinomas of Unknown Primary The American Journal of Surgical Pathology 2022-01-01 [PMID: 36730833]
• Kobayashi G, Hayashi T, Sentani K et al. ANXA10 Expression Is Inversely Associated with Tumor Stage, Grade, and TP53 Expression in Upper and Lower Urothelial Carcinoma Pathobiology : journal of immunopathology, molecular and cellular biology 2022-07-01 [PMID: 35780773]
• Ishikawa A, Kuraoka K, Zaitsu J et al. Transcriptomic Analysis of Annexin A10 and Chemosensitivity in Gastric Adenocarcinoma Cells Anticancer research 2022-04-01 [PMID: 35346989] (IF/IHC, Human)
• Chezar K, Minoo P Appendiceal sessile serrated lesions are distinct from their right-sided colonic counterparts and may be precursors for appendiceal mucinous neoplasms Human Pathology 2022-02-01 [PMID: 35121004] (IHC-P, Human)
• Ishikawa A, Kuraoka K, Zaitsu J Et al. High Annexin A10 expression is correlated with poor prognosis in pancreatic ductal adenocarcinoma Histology and histopathology 2021-11-25 [PMID: 34821375] (IHC-P, Human)
• Ishikawa A, Kuraoka K, Zaitsu J et al. Annexin A10 Expression Is Associated With Poor Prognosis in Small Bowel Adenocarcinoma Anticancer research 2021-03-01 [PMID: 33788726] (IHC-P, Human)
• Ueno T, Miura Y, Osawa H et al. Duodenal sessile serrated adenoma/polyp with characteristic endoscopic and pathologic features Clinical journal of gastroenterology 2021-03-01 [PMID: 33646513]
• Ishikawa A, Kuraoka K, Zaitsu J et al. Loss of Annexin A10 Expression Is Associated with Poor Prognosis in Early Gastric Cancer ACTA HISTOCHEMICA ET CYTOCHEMICA 2020-10-29 [PMID: 33177783] (Immunohistochemistry-Paraffin, Human)
• Marquet B, Marchal Bressenot A, Fichel C et al. Expression of the Serrated Markers Annexin A10 or Gremlin1 in Colonic Adenocarcinomas: Morphology and Prognostic Values Pathol. Oncol. Res. 2020-06-24 [PMID: 32583331]
• Tanaka, Y, Eizuka, M Et al. Traditional serrated adenoma has two distinct genetic pathways for molecular tumorigenesis with potential neoplastic progression. J Gastroenterol 2020-09-01 [PMID: 32535664] (WB, Mouse)
  
  Details:
  Citation using the HRP format of this antibody.
• Koh MJ, Shin DH, Lee SJ et al. Gastric-type gene expression and phenotype in non-terminal respiratory unit type adenocarcinoma of the lung with invasive mucinous adenocarcinoma morphology Histopathology 2020-01-27 [PMID: 31985086] (Human)
• Ishikawa A, Sakamoto N, Honma R, et al. Annexin A10 is involved in the induction of pancreatic duodenal homeobox 1 in gastric cancer tissue, cells and organoids Oncol. Rep. 2019-12-02 [PMID: 31789399] (IF/IHC, Human)
• Kodaira H, Koma YI, Hosono M et al. ANXA10 induction by interaction with tumor-associated macrophages promotes the growth of esophageal squamous cell carcinoma Pathol. Int. 2019-02-13 [PMID: 30758105] (WB, IHC-P, Human)
• Sugai T, Eizuka M, Fujita Y et al. Molecular Profiling Based on kRAS/BRAF Mutation, Methylation, and Microsatellite Statuses in Serrated Lesions. Dig. Dis. Sci. 2018-07-05 [PMID: 29974407] (IHC-P, Human)
• Boulagnon-Rombi C, Schneider C, Leandri C et al. LRP1 expression in colon cancer predicts clinical outcome. Oncotarget. 2018-02-06 [PMID: 29507659] (IHC-P, Human)
• Macaron C, Lopez R et al. Expression of Annexin A10 in Serrated Polyps Predicts the Development of Metachronous Serrated Polyps. Clin Transl Gastroenterol 2016-01-12 [PMID: 27906163] (IF/IHC, Human)
• Vayrynen SA, Vayrynen JP, Klintrup K et al. Ectopic crypt foci in conventional and serrated colorectal polyps. J. Clin. Pathol. 2016-06-08 [PMID: 27281826]
• Bae JM, Kim JH, Rhee YY et al. Annexin A10 expression in colorectal cancers with emphasis on the serrated neoplasia pathway. World J Gastroenterol 2015-09-07 [PMID: 26361422] (IF/IHC)
• Kim JH, Kim KJ, Rhee YY et al. Gastric-type expression signature in serrated pathway-associated colorectal tumors. Hum Pathol 2015-05-01 [PMID: 25704805] (Human)
• Sajanti Sa, Vayrynen Jp, Sirnio P et al. Annexin A10 is a marker for the serrated pathway of colorectal carcinoma. Virchows Arch. 2014-11-14 [PMID: 25395067]
• Wiland HO, Shadrach B, Allende D et al. Morphologic and molecular characterization of traditional serrated adenomas of the distal colon and rectum Am. J. Surg. Pathol. 2014-09-01 [PMID: 25127095]
• Kim Jung Ho, Rhee Ye-Young, Kim Kyung-Ju et al. Annexin A10 expression correlates with serrated pathway features in colorectal carcinoma with microsatellite instability. APMIS. 2014-06-07 [PMID: 24909058] (Human)
• Pai RK, Shadrach BL, Carver P et al. Immunohistochemistry for annexin A10 can distinguish sporadic from Lynch syndrome-associated microsatellite-unstable colorectal carcinoma. Am. J. Surg. Pathol. 2014-04-01 [PMID: 24625416] (IHC-P, Human)
• Gonzalo DH, Lai KK, Shadrach B et al. Gene expression profiling of serrated polyps identifies Annexin A10 as a marker of a sessile serrated adenoma/polyp. J Pathol 2013-04-17 [PMID: 23595865] (IHC-P, Human)

Reviews for Annexin A10 Antibody (NBP1-90156) (2)

Average Rating: 5

(Based on 2 reviews)

We have 2 reviews tested in 2 species: Human, Mouse.

reviewed by: Verified Customer IHC-P Mouse 12/08/2016

Summary

• Application: Immunohistochemistry-Paraffin
• Sample Tested: Paraffin sections of mouse intestine
• Species: Mouse
• Lot: N/A

reviewed by: Bryan Tinsley IHC Human 04/21/2014

Summary

• Application: Immunohistochemistry
• Species: Human

Bioinformatics

• Gene Symbol: ANXA10
• Entrez:
  • 11199(Human)
• Uniprot:
  • Q9UJ72()