Annexin A10 Antibody

Images

 
Western Blot: Annexin A10 Antibody [NBP1-90156] - Analysis in human stomach tissue.
Immunohistochemistry-Paraffin: Annexin A10 Antibody [NBP1-90156] - Staining of human tonsil shows no positivity as expected.
Immunohistochemistry-Paraffin: Annexin A10 Antibody [NBP1-90156] - Staining of human stomach shows moderate to strong nuclear positivity in glandular cells.
Immunohistochemistry-Paraffin: Annexin A10 Antibody [NBP1-90156] - Staining of human urinary bladder shows moderate nuclear positivity in urothelial cells.
Simple Western: Annexin A10 Antibody [NBP1-90156] - Simple Western lane view shows a specific band for ANXA10 in 0.2 mg/ml of U-251MG sp lysate. This experiment was performed under reducing conditions using the 12-230 ...read more
Simple Western: Annexin A10 Antibody [NBP1-90156] - Electropherogram image(s) of corresponding Simple Western lane view. Annexin A10 antibody was used at 1:20 dilution on RT-4 and U-251MG lysate(s).

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, Simple Western, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Annexin A10 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:PPLYDAHELWHAMKGVGTDENCLIEILASRTNGEIFQMREAYCLQYSNNLQEDIYSETSGHFRDTLMNLVQGTREEGYTDPAMAAQDAMVLWEACQQKTGEHKTMLQMILCNK
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (95%), Rat (97%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ANXA10
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Simple Western 1:20
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

In Simple Western only 10 - 15 uL of the recommended dilution is used per data point. Separated by Size-Wes, Sally Sue/Peggy Sue.

Theoretical MW
37 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Control Peptide
Annexin A10 Protein (NBP1-90156PEP)
Reviewed Applications
Read 1 Review rated 5
using
NBP1-90156 in the following applications:

Publications
Read Publications using
NBP1-90156 in the following applications:

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Annexin A10 Antibody

  • annexin 14
  • Annexin A10
  • annexin-10
  • annexin-14
  • ANX14
  • ANX14Annexin-10
  • ANXA10

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF808
Species: Mu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
AF3770
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NB100-56605
Species: Av, Bv, Sh
Applications: WB
NBP2-13980
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB1368
Species: Hu, Mu
Applications: WB, Simple Western, CyTOF-ready, ICC, ICFlow, KO
21310002
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
MAB3765
Species: Hu, Mu
Applications: WB, Simple Western, CyTOF-ready, ICC, ICFlow
H00007001-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP1-88899
Species: Hu
Applications: IHC, IHC-P
AF2097
Species: Hu
Applications: WB, ChIP, ICC
NB100-56630
Species: Hu
Applications: WB
NBP1-90149
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-31348
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF844
Species: Mu
Applications: WB, Block
NBP2-14934
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
248-BD/CF
Species: Hu, Mu, Rt, Ca, Eq
NBP1-91642
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-90156
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P

Publications for Annexin A10 Antibody (NBP1-90156)(8)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 2 applications: IHC, IHC-P.


Filter By Application
IHC
(1)
IHC-P
(2)
All Applications
Filter By Species
Human
(4)
All Species
Showing Publications 1 - 8 of 8.
Publications using NBP1-90156 Applications Species
Vayrynen SA, Vayrynen JP, Klintrup K et al. Ectopic crypt foci in conventional and serrated colorectal polyps. J. Clin. Pathol. Jun 8 2016 [PMID: 27281826]
Bae JM, Kim JH, Rhee YY et al. Annexin A10 expression in colorectal cancers with emphasis on the serrated neoplasia pathway. World J Gastroenterol 2015 Sep 7 [PMID: 26361422] (IHC) IHC
Kim JH, Kim KJ, Rhee YY et al. Gastric-type expression signature in serrated pathway-associated colorectal tumors. Hum Pathol 2015 May [PMID: 25704805] (Human) Human
Sajanti Sa, Vayrynen Jp, Sirnio P et al. Annexin A10 is a marker for the serrated pathway of colorectal carcinoma. Virchows Arch. 2014 Nov 14 [PMID: 25395067]
Wiland HO, Shadrach B, Allende D et al. Morphologic and molecular characterization of traditional serrated adenomas of the distal colon and rectum Am. J. Surg. Pathol. 2014 Sep 01 [PMID: 25127095]
Kim Jung Ho, Rhee Ye-Young, Kim Kyung-Ju et al. Annexin A10 expression correlates with serrated pathway features in colorectal carcinoma with microsatellite instability. APMIS. 2014 Jun 07 [PMID: 24909058] (Human) Human
Pai RK, Shadrach BL, Carver P et al. Immunohistochemistry for annexin A10 can distinguish sporadic from Lynch syndrome-associated microsatellite-unstable colorectal carcinoma. Am. J. Surg. Pathol. 2014 Apr 01 [PMID: 24625416] (IHC-P, Human) IHC-P Human
Gonzalo DH, Lai KK, Shadrach B et al. Gene expression profiling of serrated polyps identifies Annexin A10 as a marker of a sessile serrated adenoma/polyp. J Pathol 2013 Apr 17 [PMID: 23595865] (IHC-P, Human) IHC-P Human

Review for Annexin A10 Antibody (NBP1-90156) (1) 51

Average Rating: 5
(Based on 1 review)
We have 1 review tested in 1 species: Human.
We have 1 review tested in 1 application: IHC.

Reviews using NBP1-90156:
Filter by Applications
IHC
(1)
All Applications
Filter by Species
Human
(1)
All Species
Images Ratings Applications Species Date Details
Immunohistochemistry Annexin A10 NBP1-90156
Enlarge
reviewed by:
Anony- mous
IHC Human 04/21/2014
View

Summary

ApplicationImmunohistochemistry
SpeciesHuman
FileView PDF

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Annexin A10 Antibody (NBP1-90156) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Annexin A10 Products

Bioinformatics Tool for Annexin A10 Antibody (NBP1-90156)

Discover related pathways, diseases and genes to Annexin A10 Antibody (NBP1-90156). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Annexin A10 Antibody (NBP1-90156)

Discover more about diseases related to Annexin A10 Antibody (NBP1-90156).
 

Pathways for Annexin A10 Antibody (NBP1-90156)

View related products by pathway.

PTMs for Annexin A10 Antibody (NBP1-90156)

Learn more about PTMs related to Annexin A10 Antibody (NBP1-90156).
 

Research Areas for Annexin A10 Antibody (NBP1-90156)

Find related products by research area.

Blogs on Annexin A10

There are no specific blogs for Annexin A10, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

5
5
1
4
0
3
0
2
0
1
0

Anony- mous
04/21/2014
Application: IHC
Species: Human

Bioinformatics

Gene Symbol ANXA10
Entrez
Uniprot