Anillin Antibody (CL0303)

Images

 
Western Blot: Anillin Antibody (CL0303) [NBP2-52908] - Lane 1: Marker [kDa] Lane 2:Human cell line U-251 MG
Immunocytochemistry/ Immunofluorescence: Anillin Antibody (CL0303) [NBP2-52908] - Staining in U251 cell line with Anti-ANLN monoclonal antibody, showing cell cycle dependent nuclear (without nucleoli) staining in green. ...read more
Immunohistochemistry-Paraffin: Anillin Antibody (CL0303) [NBP2-52908] - Staining in human testis and skeletal muscle tissues. Corresponding ANLN RNA-seq data are presented for the same tissues.
Genetic Strategies: Western Blot: Anillin Antibody (CL0303) [NBP2-52908] - Analysis in U-251MG cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-ANLN antibody. Remaining ...read more
Western Blot: Anillin Antibody (CL0303) [NBP2-52908] - Interaction of Anillin with GST-fused protein: MDA-MB-231 cells were lysed in TBS, pH 7.5, containing 0.75% Triton X-100 with inhibitors of proteases and ...read more
Immunocytochemistry/ Immunofluorescence: Anillin Antibody (CL0303) [NBP2-52908] - Staining in A431 cell line with Anti-ANLN monoclonal antibody, showing cell cycle dependent nuclear (without nucleoli) staining in green. ...read more
Immunocytochemistry/ Immunofluorescence: Anillin Antibody (CL0303) [NBP2-52908] - Staining in HeLa cell line with Anti-ANLN monoclonal antibody, showing cell cycle dependent nuclear (without nucleoli) staining in green. ...read more
Immunocytochemistry/ Immunofluorescence: Anillin Antibody (CL0303) [NBP2-52908] - Staining in MCF7 cell line with Anti-ANLN monoclonal antibody, showing cell cycle dependent nuclear (without nucleoli) staining in green. ...read more
Immunocytochemistry/ Immunofluorescence: Anillin Antibody (CL0303) [NBP2-52908] - Staining in U2OS cell line with Anti-ANLN monoclonal antibody, showing cell cycle dependent nuclear (without nucleoli) staining in green. ...read more
Immunohistochemistry-Paraffin: Anillin Antibody (CL0303) [NBP2-52908] - Staining of human colorectal cancer shows moderate to strong nuclear positivity in a subset of tumor cells.
Immunohistochemistry-Paraffin: Anillin Antibody (CL0303) [NBP2-52908] - Staining of human testis shows moderate to strong nuclear positivity in a subset of cells in seminiferous ducts.
Immunohistochemistry-Paraffin: Anillin Antibody (CL0303) [NBP2-52908] - Staining of human rectum shows moderate to strong nuclear positivity in a subset of glandular cells.
Immunohistochemistry-Paraffin: Anillin Antibody (CL0303) [NBP2-52908] - Staining of human skin shows moderate to strong nuclear positivity in a subset of dermal cells.
Immunohistochemistry-Paraffin: Anillin Antibody (CL0303) [NBP2-52908] - Staining of human skeletal muscle shows no nuclear positivity in striated muscle fibers as expected.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P, KD
Clone
CL0303
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated
Validated by:
     

Genetic Strategies

   

Order Details

Anillin Antibody (CL0303) Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: IVKSTLSQTVPSKGELSREICLQSQSKDKSTTPGGTGIKPFLERFGERCQEHSKESPARSTPHRTPIITPNTKAIQERLFKQDTSSSTTHLAQQLKQERQKELACLRGRFDKGNIWSAEKGGNSKSKQLETKQETH
Epitope
LRGRFDKGNIWSAEK
Specificity
Specificity of human Anillin antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG1
Clonality
Monoclonal
Host
Mouse
Gene
ANLN
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1 ug/ml
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Knockdown Validated
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Anillin Recombinant Protein Antigen (NBP2-52908PEP)
Reviewed Applications
Read 1 Review rated 5
using
NBP2-52908 in the following applications:

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Protein A purified

Alternate Names for Anillin Antibody (CL0303)

  • actin-binding protein anillin
  • anillin (Drosophila Scraps homolog), actin binding protein
  • ANILLIN
  • anillin, actin binding protein (scraps homolog, Drosophila)
  • anillin, actin binding protein
  • DKFZp779A055
  • Drosophila Scraps homolog
  • scra
  • Scraps

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-32975
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
AF1107
Species: Mu
Applications: WB, IHC
H00003347-M01
Species: Hu
Applications: ELISA, ICC/IF
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
NBP1-84550
Species: Hu
Applications: WB, IHC, IHC-P
H00347527-P01
Species: Hu
NB100-866
Species: Hu, Mu, Rt, Po
Applications: WB, IHC, IHC-P, PEP-ELISA
AF1356
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready
NBP2-45731
Species: Hu, Ca, Mk
Applications: WB, IHC, IHC-P
AF2009
Species: Hu
Applications: IHC, ICC
NBP1-83790
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB600-534
Species: Hu, Mu, Po, Vi
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, RIA
NB100-1598
Species: Hu, Mu
Applications: WB, Flow, ICC/IF
NBP2-58917
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-89158
Species: Hu, Rt
Applications: WB, Simple Western, IHC, IHC-P
NBP1-32244
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-86616
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-67605
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-52908
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD

Publications for Anillin Antibody (NBP2-52908) (0)

There are no publications for Anillin Antibody (NBP2-52908).
By submitting your publication information earn gift cards and discounts for future purchases.

Review for Anillin Antibody (NBP2-52908) (1) 51

Average Rating: 5
(Based on 1 review)
We have 1 review tested in 1 species: Human.

Reviews using NBP2-52908:
Filter by Applications
WB
(1)
All Applications
Filter by Species
Human
(1)
All Species
Images Ratings Applications Species Date Details
Western Blot Anillin NBP2-52908
Enlarge
reviewed by:
Anonymous
WB Human 01/15/2018
View

Summary

ApplicationWestern Blot
Sample TestedGST-pull down assay
SpeciesHuman
Lot02616

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Anillin Antibody (NBP2-52908) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for Anillin Antibody (NBP2-52908)

Discover related pathways, diseases and genes to Anillin Antibody (NBP2-52908). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Anillin Antibody (NBP2-52908)

Discover more about diseases related to Anillin Antibody (NBP2-52908).
 

Pathways for Anillin Antibody (NBP2-52908)

View related products by pathway.

PTMs for Anillin Antibody (NBP2-52908)

Learn more about PTMs related to Anillin Antibody (NBP2-52908).

Blogs on Anillin

There are no specific blogs for Anillin, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

5
5
1
4
0
3
0
2
0
1
0

Anonymous
01/15/2018
Application: WB
Species: Human

Bioinformatics

Gene Symbol ANLN