Angiopoietin-like Protein 6/ANGPTL6 Antibody - BSA Free

Western Blot: Angiopoietin-like Protein 6/ANGPTL6 Antibody [NBP3-10663] - Western blot analysis of Angiopoietin-like Protein 6/ANGPTL6 in Thymus Tumor. Antibody dilution at 1.0ug/ml

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

Angiopoietin-like Protein 6/ANGPTL6 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Angiopoietin-like Protein 6/ANGPTL6 Antibody - BSA Free (NBP3-10663) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen for Anti-Angiopoietin-like Protein 6/ANGPTL6 antibody is: synthetic peptide directed towards the C-terminal region of Human ANGL6 (NP_114123.2). Peptide sequence PESDHYRLRLGQYHGDAGDSLSWHNDKPFSTVDRDRDSYSGNCALYQRGG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ANGPTL6
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 51 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for Angiopoietin-like Protein 6/ANGPTL6 Antibody - BSA Free

• AGF
• AGFAngiopoietin-related protein 5
• Angiopoietin like Protein 6
• angiopoietin-like 6
• Angiopoietin-like Protein 6
• Angiopoietin-related growth factor
• ANGPTL6
• ARP5
• ARP5angiopoietin-related protein 6

Background

ANGPTL6 may play a role in the wound healing process. May promote epidermal proliferation, remodeling andregeneration. May promote the chemotactic activity of endothelial cells and induce neovascularization. May counteracthigh-fat diet-induced obesity and related

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ANGPTL6