Angiopoietin-4 Antibody (1B7) - Azide and BSA Free

Immunohistochemistry-Paraffin: Angiopoietin-4 Antibody (1B7) [H00051378-M01] - Analysis of monoclonal antibody to ANGPT4 on formalin-fixed paraffin-embedded human salivary gland. Antibody concentration 3 ug/ml.

Sandwich ELISA: Angiopoietin-4 Antibody (1B7) [H00051378-M01] - Detection limit for recombinant GST tagged ANGPT4 is 0.3 ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: WB, ELISA, IHC
• Clone: 1B7
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

Angiopoietin-4 Antibody (1B7) - Azide and BSA Free Summary

• Description: Novus Biologicals Mouse Angiopoietin-4 Antibody (1B7) - Azide and BSA Free (H00051378-M01) is a monoclonal antibody validated for use in IHC, WB and ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: ANGPT4 (NP_057069, 25 a.a. ~ 111 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. TRQEADRGCETLVVQHGHCSYTFLLPKSEPCPPGPEVSRDSNTLQRESLANPLHLGKLPTQQVKQLEQALQNNTQWLKKLERAIKTI
• Specificity: Reacts with angiopoietin 4.
• Isotype: IgG2b Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: ANGPT4
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Sandwich ELISA
  • Western Blot
• Application Notes: This antibody is reactive against recombinant protein in western blot and ELISA.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Angiopoietin-4 Antibody (1B7) - Azide and BSA Free

• AGP4
• ANG3
• ANG-3
• ANG-4
• ANG4angiopoietin-3
• angiopoietin 4
• Angiopoietin-3
• Angiopoietin-4
• ANGPT4
• dJ824F16.2 (angiopoietin 4)
• MGC138181
• MGC138183

Background

Angiopoietins are proteins with important roles in vascular development and angiogenesis. All angiopoietins bind with similar affinity to an endothelial cell-specific tyrosine-protein kinase receptor. The mechanism by which they contribute to angiogenesis is thought to involve regulation of endothelial cell interactions with supporting perivascular cells. The protein encoded by this gene functions as an agonist and is an angiopoietin. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ANGPT4
• Entrez:
  • 51378(Human)
• Uniprot:
  • NP_057069(Human)