ANAPC15 Antibody

Images

 
Western Blot: ANAPC15 Antibody [NBP1-84151] - Analysis in control (vector only transfected HEK293T lysate) and ANAPC15 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T ...read more
Immunocytochemistry/ Immunofluorescence: ANAPC15 Antibody [NBP1-84151] - Staining of human cell line U-2 OS shows localization to nucleoplasm & vesicles.
Immunohistochemistry-Paraffin: ANAPC15 Antibody [NBP1-84151] - Staining of human appendix shows strong cytoplasmic positivity in lymphoid cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ANAPC15 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: PSLFPRVTETLWFNLDRPCVEETELQQQEQQHQAWLQSIAEKDNNLVPIGKPASEHYDDEEEED
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ANAPC15
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ANAPC15 Recombinant Protein Antigen (NBP1-84151PEP)
Publications
Read Publication using NBP1-84151.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23435261)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ANAPC15 Antibody

  • anaphase promoting complex subunit 15
  • APC15
  • C11orf51
  • chromosome 11 open reading frame 51
  • DKFZP564M082
  • HSPC020
  • hypothetical protein LOC25906

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-66987
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NB100-91662
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NB100-563
Species: Hu
Applications: ICC/IF, IHC, IHC-P, IP, WB
NB100-59828
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
NBP3-07374
Species: Hu
Applications: Flow, ICC/IF, PA, WB
AF6000
Species: Hu, Mu
Applications: IHC, Simple Western, WB
NB100-353
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC/IF, IP, WB
NBP3-12270
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, WB
NBP1-88517
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, KD, WB
NBP2-33466
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-24570
Species: Hu, Mu
Applications: IHC, IHC-P, Simple Western, WB
NBP2-13954
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-31661
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NB100-56479
Species: Bv, Ca, Hu, Mu, Po, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-15840
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-75659
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP2-67820
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
AF748
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
NBP1-86217
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-85885
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB

Publications for ANAPC15 Antibody (NBP1-84151)(1)

Reviews for ANAPC15 Antibody (NBP1-84151) (0)

There are no reviews for ANAPC15 Antibody (NBP1-84151). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for ANAPC15 Antibody (NBP1-84151) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ANAPC15 Products

Bioinformatics Tool for ANAPC15 Antibody (NBP1-84151)

Discover related pathways, diseases and genes to ANAPC15 Antibody (NBP1-84151). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on ANAPC15

There are no specific blogs for ANAPC15, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ANAPC15 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ANAPC15