Amylin Antibody

Images

 
Western Blot: Amylin Antibody [NBP1-69210] - Jurkat cell lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Amylin Antibody Summary

Immunogen
Synthetic peptides corresponding to IAPP (islet amyloid polypeptide) The peptide sequence was selected from the N terminal of IAPP (NP_000406). Peptide sequence MGILKLQVFLIVLSVALNHLKATPIESHQVEKRKCNTATCATQRLANFLV.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
IAPP
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.2-1 ug/ml
Theoretical MW
4 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
From PBS & 2% Sucrose.
Preservative
No Preservative
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Amylin Antibody

  • AMYLIN
  • DAPamylin
  • Diabetes-associated peptide
  • IAP
  • Insulinoma amyloid peptide
  • Islet amyloid polypeptide (diabetes-associated peptide; amylin)
  • islet amyloid polypeptide

Background

Islet, or insulinoma, amyloid polypeptide is commonly found in pancreatic islets of patients suffering diabetes mellitus type II, or harboring an insulinoma. While the assosciation of amylin with the development of type II diabetes has been known for some time, a direct causative role for amylin has been harder to establish. Studies suggest that amylin, like the related beta-amyloid (Abeta) associated with Alzheimer's disease, can induce apoptotic cell-death in particular cultured cells, an effect that may be relevant to the development of type II diabetes.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
AF8221
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
NB120-14817
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, S-ELISA
MAB1249
Species: Hu, Mu
Applications: CyTOF-ready, ICC, ICFlow
NB500-201
Species: Hu, Mu, Rt, Ca, Fe, GP, Ha
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
AF1052
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready
NB100-56311
Species: Hu
Applications: WB, ICC/IF, IHC-P
AF2558
Species: Hu, Mu
Applications: WB, Simple Western
H00004068-M01
Species: Hu
Applications: WB, ELISA
NB500-201
Species: Hu, Mu, Rt, Ca, Fe, GP, Ha
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB100-56708
Species: Hu, Mu, Rt, Po, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready
NBP2-31106
Species: Hu
Applications: WB, Flow, IHC, IHC-P, IP, CyTOF-ready, Flow-CS
NBP1-27972
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
MAB2358
Species: Hu, Mu
Applications: IHC, ICC
NBP2-37387
Species: Hu
Applications: WB, ELISA, Flow, CyTOF-ready
NB100-1793
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr, IHC-P, PEP-ELISA
AF6108
Species: Hu
Applications: IHC
NBP1-35641
Species: Hu
Applications: WB, IHC, IHC-P

Publications for Amylin Antibody (NBP1-69210) (0)

There are no publications for Amylin Antibody (NBP1-69210).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Amylin Antibody (NBP1-69210) (0)

There are no reviews for Amylin Antibody (NBP1-69210). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Amylin Antibody (NBP1-69210) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Amylin Products

Bioinformatics Tool for Amylin Antibody (NBP1-69210)

Discover related pathways, diseases and genes to Amylin Antibody (NBP1-69210). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Amylin Antibody (NBP1-69210)

Discover more about diseases related to Amylin Antibody (NBP1-69210).
 

Pathways for Amylin Antibody (NBP1-69210)

View related products by pathway.

PTMs for Amylin Antibody (NBP1-69210)

Learn more about PTMs related to Amylin Antibody (NBP1-69210).
 

Research Areas for Amylin Antibody (NBP1-69210)

Find related products by research area.

Blogs on Amylin

There are no specific blogs for Amylin, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Amylin Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol IAPP
Entrez
Uniprot