Amylin Antibody


Western Blot: Amylin Antibody [NBP1-69210] - Jurkat cell lysate, concentration 0.2-1 ug/ml.

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

Amylin Antibody Summary

Synthetic peptides corresponding to IAPP (islet amyloid polypeptide) The peptide sequence was selected from the N terminal of IAPP (NP_000406). Peptide sequence MGILKLQVFLIVLSVALNHLKATPIESHQVEKRKCNTATCATQRLANFLV.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.2-1 ug/ml
Theoretical MW
4 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
From PBS & 2% Sucrose.
No Preservative
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Amylin Antibody

  • DAPamylin
  • Diabetes-associated peptide
  • IAP
  • Insulinoma amyloid peptide
  • Islet amyloid polypeptide (diabetes-associated peptide; amylin)
  • islet amyloid polypeptide


Islet, or insulinoma, amyloid polypeptide is commonly found in pancreatic islets of patients suffering diabetes mellitus type II, or harboring an insulinoma. While the assosciation of amylin with the development of type II diabetes has been known for some time, a direct causative role for amylin has been harder to establish. Studies suggest that amylin, like the related beta-amyloid (Abeta) associated with Alzheimer's disease, can induce apoptotic cell-death in particular cultured cells, an effect that may be relevant to the development of type II diabetes.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, S-ELISA
Species: Hu, Mu
Applications: CyTOF-ready, ICC, ICFlow
Species: Hu, Mu, Rt, Ca, Fe, GP, Ha
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, Simple Western
Species: Hu
Applications: WB, ELISA
Species: Hu, Mu, Rt, Ca, Fe, GP, Ha
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Hu, Mu, Rt, Po, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, KO
Species: Hu
Applications: WB, Flow, IHC, IHC-P, IP, CyTOF-ready, Flow-CS, ICC
Species: Hu
Applications: WB, IHC, KO
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: IHC, ICC
Species: Bv
Applications: WB, ELISA, IHC, IHC-P
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr, IHC-P, PEP-ELISA
Species: Hu
Applications: IHC
Species: Hu
Applications: IHC, IHC-P

Publications for Amylin Antibody (NBP1-69210) (0)

There are no publications for Amylin Antibody (NBP1-69210).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Amylin Antibody (NBP1-69210) (0)

There are no reviews for Amylin Antibody (NBP1-69210). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Amylin Antibody (NBP1-69210) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Amylin Products

Bioinformatics Tool for Amylin Antibody (NBP1-69210)

Discover related pathways, diseases and genes to Amylin Antibody (NBP1-69210). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Amylin Antibody (NBP1-69210)

Discover more about diseases related to Amylin Antibody (NBP1-69210).

Pathways for Amylin Antibody (NBP1-69210)

View related products by pathway.

PTMs for Amylin Antibody (NBP1-69210)

Learn more about PTMs related to Amylin Antibody (NBP1-69210).

Research Areas for Amylin Antibody (NBP1-69210)

Find related products by research area.

Blogs on Amylin

There are no specific blogs for Amylin, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Amylin Antibody and receive a gift card or discount.


Gene Symbol IAPP