Amylin Antibody - Azide and BSA Free Summary
| Description |
Quality control test: Antibody reactive against mammalian tissue lysate. |
| Immunogen |
IAPP (NP_000406.1, 1 a.a. - 89 a.a.) full-length human protein. MGILKLQVFLIVLSVALNHLKATPIESHQVEKRKCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTYGKRNAVEVLKREPLNYLPL |
| Specificity |
Reacts with islet amyloid polypeptide. |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
IAPP |
| Purity |
Protein A purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
|
| Application Notes |
This antibody is reactive against transfected lysate and as a detection antibody in ELISA. |
| Publications |
|
Packaging, Storage & Formulations
| Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.4) |
| Preservative |
No Preservative |
| Purity |
Protein A purified |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for Amylin Antibody - Azide and BSA Free
Background
Islet, or insulinoma, amyloid polypeptide is commonly found in pancreatic islets of patients suffering diabetes mellitus type II, or harboring an insulinoma. While the assosciation of amylin with the development of type II diabetes has been known for some time, a direct causative role for amylin has been harder to establish. Studies suggest that amylin, like the related beta-amyloid (Abeta) associated with Alzheimer's disease, can induce apoptotic cell-death in particular cultured cells, an effect that may be relevant to the development of type II diabetes. [provided by RefSeq]
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Bv, Hu, Mu
Applications: ICC, IHC
Species: Hu, Mu, Rt
Applications: IHC, KO, Simple Western, WB
Species: Hu, Rt
Applications: ICC/IF, IHC, S-ELISA, WB
Species: Hu, Mu
Applications: CyTOF-ready, ICC, ICFlow
Species: Ca, Fe, Gp, Ha, Hu, Mu, Rt
Applications: ChIP, Dual ISH-IHC, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, Simple Western, WB
Species: Hu
Applications: CyTOF-ready, Flow, IHC, Simple Western, WB
Species: Hu
Applications: BA
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Mu
Applications: ELISA
Species: Hu, Mu
Applications: ELISA, Flow, Func, WB
Species: Ca, Fe, Gp, Ha, Hu, Mu, Rt
Applications: ChIP, Dual ISH-IHC, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, Simple Western, WB
Species: Hu, Mu
Applications: ICC, IHC
Species: Hu
Applications: CyTOF-ready, Flow, IHC, KO, Neut, WB
Species: Hu
Applications: IHC, KO, Simple Western, WB
Species: Hu
Applications: IHC, Simple Western, WB
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P
Species: Dr, Hu, Mu
Applications: IHC, IHC-P, WB
Species: Hu, Pm, Mu, Rt
Applications: Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, PEP-ELISA
Species: Hu
Applications: IHC
Species: Hu
Applications: IHC, IHC-P
Publications for Amylin Antibody (H00003375-D01P)(1)
Showing Publication 1 -
1 of 1.
Reviews for Amylin Antibody (H00003375-D01P) (0)
There are no reviews for Amylin Antibody (H00003375-D01P).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Amylin Antibody (H00003375-D01P). (Showing 1 - 2 of 2 FAQ).
-
I was wondering if you knew/could find out the Kd (dissociation) of this Ab to human Amylin?
- Our lab has informed me that the dissociation constant for this Ab and its antigen has not been tested.
-
I am trying to detect Human amylin/Human Amylin Oligomer expressed in tissues of Human amylin transgenic mice via Western blot and immunohistochemistry. I have found 3 antibodies from your website that may be suitable for the work. Amylin Antibody (NBP1-74545), Amylin Antibody (NBP1-69210), and Amylin Antibody (H00003375-D01P). I am just wondering if you could recommend one or two that maybe best suited for work I planned to do? The antibody should be specifically for human and does not cross react with mouse or rat.
- The peptide for NBP1-69210 shares 69% similarity with mouse so it probably won't cross-react but we can not guarantee that. H00003375-D01P is generated against the full-length protein which shares 66% similarity with mouse. Chances are neither of these will cross-react but they haven't been specifically tested for this so we can not guarantee it at this time. These two would be your best be to try.
Secondary Antibodies
| |
Isotype Controls
|
Additional Amylin Products
Research Areas for Amylin Antibody (H00003375-D01P)
Find related products by research area.
|
Blogs on Amylin