Amylin Antibody

Images

 
Western Blot: Amylin Antibody [H00003375-D01P] - Analysis of IAPP expression in human spleen.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Amylin Antibody Summary

Immunogen
IAPP (NP_000406.1, 1 a.a. - 89 a.a.) full-length human protein. MGILKLQVFLIVLSVALNHLKATPIESHQVEKRKCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTYGKRNAVEVLKREPLNYLPL
Specificity
Reacts with islet amyloid polypeptide.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
IAPP
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
This antibody is reactive against transfected lysate and as a detection antibody in ELISA.
Publications
Read Publication using H00003375-D01P.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody reactive against mammalian tissue lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Amylin Antibody

  • AMYLIN
  • DAPamylin
  • Diabetes-associated peptide
  • IAP
  • Insulinoma amyloid peptide
  • Islet amyloid polypeptide (diabetes-associated peptide; amylin)
  • islet amyloid polypeptide

Background

Islet, or insulinoma, amyloid polypeptide is commonly found in pancreatic islets of patients suffering diabetes mellitus type II, or harboring an insulinoma. While the assosciation of amylin with the development of type II diabetes has been known for some time, a direct causative role for amylin has been harder to establish. Studies suggest that amylin, like the related beta-amyloid (Abeta) associated with Alzheimer's disease, can induce apoptotic cell-death in particular cultured cells, an effect that may be relevant to the development of type II diabetes. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
AF8221
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
NB120-14817
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, S-ELISA
MAB1249
Species: Hu, Mu
Applications: CyTOF-ready, ICC, ICFlow
NB500-201
Species: Hu, Mu, Rt, Ca, Fe, GP, Ha
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
AF1052
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready
NB100-56311
Species: Hu
Applications: WB, ICC/IF, IHC-P
AF2558
Species: Hu, Mu
Applications: WB, Simple Western
H00004068-M01
Species: Hu
Applications: WB, ELISA
NB500-201
Species: Hu, Mu, Rt, Ca, Fe, GP, Ha
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB100-56708
Species: Hu, Mu, Rt, Po, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready
NBP2-31106
Species: Hu
Applications: WB, Flow, IHC, IHC-P, IP, CyTOF-ready, Flow-CS
NBP1-27972
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
MAB2358
Species: Hu, Mu
Applications: IHC, ICC
NBP2-37387
Species: Hu
Applications: WB, ELISA, Flow, CyTOF-ready
NB100-1793
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr, IHC-P, PEP-ELISA
AF6108
Species: Hu
Applications: IHC
NBP1-35641
Species: Hu
Applications: WB, IHC, IHC-P

Publications for Amylin Antibody (H00003375-D01P)(1)

Reviews for Amylin Antibody (H00003375-D01P) (0)

There are no reviews for Amylin Antibody (H00003375-D01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Amylin Antibody (H00003375-D01P). (Showing 1 - 2 of 2 FAQ).

  1. I was wondering if you knew/could find out the Kd (dissociation) of this Ab to human Amylin?
    • Our lab has informed me that the dissociation constant for this Ab and its antigen has not been tested.
  2. I am trying to detect Human amylin/Human Amylin Oligomer expressed in tissues of Human amylin transgenic mice via Western blot and immunohistochemistry. I have found 3 antibodies from your website that may be suitable for the work. Amylin Antibody (NBP1-74545), Amylin Antibody (NBP1-69210), and Amylin Antibody (H00003375-D01P). I am just wondering if you could recommend one or two that maybe best suited for work I planned to do? The antibody should be specifically for human and does not cross react with mouse or rat.
    • The peptide for NBP1-69210 shares 69% similarity with mouse so it probably won't cross-react but we can not guarantee that. H00003375-D01P is generated against the full-length protein which shares 66% similarity with mouse. Chances are neither of these will cross-react but they haven't been specifically tested for this so we can not guarantee it at this time. These two would be your best be to try.

Secondary Antibodies

 

Isotype Controls

Additional Amylin Products

Bioinformatics Tool for Amylin Antibody (H00003375-D01P)

Discover related pathways, diseases and genes to Amylin Antibody (H00003375-D01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Amylin Antibody (H00003375-D01P)

Discover more about diseases related to Amylin Antibody (H00003375-D01P).
 

Pathways for Amylin Antibody (H00003375-D01P)

View related products by pathway.

PTMs for Amylin Antibody (H00003375-D01P)

Learn more about PTMs related to Amylin Antibody (H00003375-D01P).

Blogs on Amylin

There are no specific blogs for Amylin, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Amylin Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol IAPP
Entrez
Uniprot