Amylin Antibody - Azide and BSA Free

Western Blot: Amylin Antibody [H00003375-D01P] - Analysis of IAPP expression in human spleen.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: Azide and BSA Free

Amylin Antibody - Azide and BSA Free Summary

• Description: Quality control test: Antibody reactive against mammalian tissue lysate.
• Immunogen: IAPP (NP_000406.1, 1 a.a. - 89 a.a.) full-length human protein. MGILKLQVFLIVLSVALNHLKATPIESHQVEKRKCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTYGKRNAVEVLKREPLNYLPL
• Specificity: Reacts with islet amyloid polypeptide.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: IAPP
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Western Blot
• Application Notes: This antibody is reactive against transfected lysate and as a detection antibody in ELISA.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.4)
• Preservative: No Preservative
• Purity: Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Amylin Antibody - Azide and BSA Free

• AMYLIN
• DAPamylin
• Diabetes-associated peptide
• IAP
• Insulinoma amyloid peptide
• Islet amyloid polypeptide (diabetes-associated peptide; amylin)
• islet amyloid polypeptide

Background

Islet, or insulinoma, amyloid polypeptide is commonly found in pancreatic islets of patients suffering diabetes mellitus type II, or harboring an insulinoma. While the assosciation of amylin with the development of type II diabetes has been known for some time, a direct causative role for amylin has been harder to establish. Studies suggest that amylin, like the related beta-amyloid (Abeta) associated with Alzheimer's disease, can induce apoptotic cell-death in particular cultured cells, an effect that may be relevant to the development of type II diabetes. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Amylin Antibody (H00003375-D01P)(1)

Publication using H00003375-D01P

• Ladiwala AR, Bhattacharya M, Perchiacca JM et al. Rational design of potent domain antibody inhibitors of amyloid fibril assembly. Proc Natl Acad Sci U S A. 2012-11-15 [PMID: 23161913]

FAQs for Amylin Antibody (H00003375-D01P). (Showing 1 - 2 of 2 FAQ).

1. I was wondering if you knew/could find out the Kd (dissociation) of this Ab to human Amylin?
   • Our lab has informed me that the dissociation constant for this Ab and its antigen has not been tested.
2. I am trying to detect Human amylin/Human Amylin Oligomer expressed in tissues of Human amylin transgenic mice via Western blot and immunohistochemistry. I have found 3 antibodies from your website that may be suitable for the work. Amylin Antibody (NBP1-74545), Amylin Antibody (NBP1-69210), and Amylin Antibody (H00003375-D01P). I am just wondering if you could recommend one or two that maybe best suited for work I planned to do? The antibody should be specifically for human and does not cross react with mouse or rat.
   • The peptide for NBP1-69210 shares 69% similarity with mouse so it probably won't cross-react but we can not guarantee that. H00003375-D01P is generated against the full-length protein which shares 66% similarity with mouse. Chances are neither of these will cross-react but they haven't been specifically tested for this so we can not guarantee it at this time. These two would be your best be to try.

Bioinformatics

• Gene Symbol: IAPP
• Entrez:
  • 3375(Human)
• Uniprot:
  • NP_000406.1(Human)