AMSH-LP Antibody

Images

 
Western Blot: STAMBPL1 Antibody [NBP1-56334] - Antibody Titration: 1 ug/ml Human K562.
Western Blot: STAMBPL1 Antibody [NBP1-56334] - Jurkat cell lysate, concentration 0.2-1 ug/ml.
Western Blot: STAMBPL1 Antibody [NBP1-56334] - Antibody Titration: 1 ug/ml Human Daudi.
Western Blot: STAMBPL1 Antibody [NBP1-56334] - Antibody Titration: 1 ug/ml Human MDA-MB-435s.

Product Details

Summary
Reactivity Hu, Mu, Rt, Bv, Ca, Eq, GP, Rb, ZeSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

AMSH-LP Antibody Summary

Immunogen
Synthetic peptides corresponding to STAMBPL1(STAM binding protein-like 1) The peptide sequence was selected from the N terminal of STAMBPL1. Peptide sequence MDQPFTVNSLKKLAAMPDHTDVSLSPEERVRALSKLGCNITISEDITPRR.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
STAMBPL1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against STAMBPL1 and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for AMSH-LP Antibody

  • ALMalpha
  • AMSH-FP
  • AMSHLP
  • AMSH-LP
  • STAMBPL1

Background

STAMBPL1 is a zinc metalloprotease that specifically cleaves 'Lys-63'-linked polyubiquitin chains.STAMBPL1 does not cleave 'Lys-48'-linked polyubiquitin chains.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF5650
Species: Hu
Applications: WB, IHC
E-325
Species: Hu
NBP2-38514
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB120-495
Species: Hu, Mu, Rt, Dr
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-80956
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IP
NBP1-30961
Species: Hu
Applications: WB, ChIP, IHC, IHC-P
NBP2-38780
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83220
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
H00006430-B01P
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-55249
Species: Hu, Mu
Applications: WB, IP
AF1988
Species: Hu
Applications: WB, IP, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
AF1280
Species: Mu
Applications: WB, Simple Western, IHC
NBP2-37761
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-90044
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-866
Species: Hu, Mu, Rt, Po
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP1-56334
Species: Hu, Mu, Rt, Bv, Ca, Eq, GP, Rb, Ze
Applications: WB

Publications for STAMBPL1 Antibody (NBP1-56334) (0)

There are no publications for STAMBPL1 Antibody (NBP1-56334).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for STAMBPL1 Antibody (NBP1-56334) (0)

There are no reviews for STAMBPL1 Antibody (NBP1-56334). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for STAMBPL1 Antibody (NBP1-56334) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional AMSH-LP Products

Bioinformatics Tool for STAMBPL1 Antibody (NBP1-56334)

Discover related pathways, diseases and genes to STAMBPL1 Antibody (NBP1-56334). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for STAMBPL1 Antibody (NBP1-56334)

Discover more about diseases related to STAMBPL1 Antibody (NBP1-56334).
 

Pathways for STAMBPL1 Antibody (NBP1-56334)

View related products by pathway.

PTMs for STAMBPL1 Antibody (NBP1-56334)

Learn more about PTMs related to STAMBPL1 Antibody (NBP1-56334).

Blogs on AMSH-LP

There are no specific blogs for AMSH-LP, but you can read our latest blog posts.
Recombinant Monoclonal Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our AMSH-LP Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol STAMBPL1
Uniprot