Aminopeptidase N/CD13 Recombinant Protein Antigen

Images

 
There are currently no images for Aminopeptidase N/CD13 Recombinant Protein Antigen (NBP2-33855PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Aminopeptidase N/CD13 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ANPEP.

Source: E. coli

Amino Acid Sequence: PNTLKPDSYRVTLRPYLTPNDRGLYVFKGSSTVRFTCKEATDVIIIHSKKLNYTLSQGHRVVLRGVGGSQPPDIDKTELVEPTEYLVVHLKGSLVKDSQYEMDSEFEGELADDLAGFYRSEYMEGNVRKVVATTQMQA

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
ANPEP
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-33855.It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com
Theoretical MW
33 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Aminopeptidase N/CD13 Recombinant Protein Antigen

  • alanyl (membrane) aminopeptidase
  • Alanyl aminopeptidase
  • Aminopeptidase M
  • Aminopeptidase N
  • ANPEP
  • AP-M
  • APN
  • AP-N
  • CD13 antigen
  • CD13
  • CD13APN
  • EC 3.4.11
  • EC 3.4.11.2
  • gp150
  • LAP1
  • Microsomal aminopeptidase
  • Myeloid plasma membrane glycoprotein CD13
  • p150
  • PEPN
  • PEPNhAPN

Background

Alanine aminopeptidase (CD13) is expressed on the majority of peripheral blood monocytes and granulocytes. CD13 is also expressed by the majority of acute myeloid leukemias, chronic myeloid leukemias in myeloid blast crisis, a smaller percentage of lymphoid leukemias and myeloid cell lines. CD13 is also found in several types of non hematopoietic cells such as fibroblasts and endothelial cells and in a soluble form in blood plasma. CD13 is not expressed on B cells, T cells, platelets or erythrocytes. In the mouse, CD13 is a non-covalently linked homodimer of approximately 150kD subunits expressed by a variety of cells including monocytes, macrophages, dendritic cell and veiled cells. CD13 plays a role in biologically active peptide metabolism, in the control of growth and differentiation, in phagocytosis and in bactericidal/tumoricidal activities. CD13 also serves as a receptor for human coronaviruses.

CD13 is commonly used as a biomarker to detect damage to the kidneys, and that may be used to help diagnose certain kidney disorders. Therefore, CD13 antibodies are useful tools for cancer and renal disorder research.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-22377
Species: Hu
Applications: IHC,  IHC-P, WB
NBP2-79843
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC,  IHC-P, PA, WB
7268-CT
Species: Hu
Applications: BA
AF1126
Species: Mu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, IP, WB
NB100-524
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
AF1180
Species: Hu
Applications: ICC, IHC, Simple Western, WB
AF4117
Species: Rt
Applications: IHC, WB
AF1730
Species: Hu
Applications: AdBlk, CyTOF-ready, Flow, ICC
NB110-89474
Species: Bv, Ce, ChHa, Hu, Pm, Mu, Rt, RM
Applications: Dual ISH-IHC, Flow-CS, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, ISH, Simple Western, Single-Cell Western, WB
NBP2-80573
Species: Mu
Applications: CyTOF-ready, Flow, IHC,  IHC-P, IP
DC140
Species: Hu
Applications: ELISA
NBP2-93743
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
NB500-328
Species: Hu
Applications: CyTOF-ready, Flow, IP
NBP2-25196
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC/IF, In vitro, WB
AF114
Species: Mu
Applications: CyTOF-ready, Flow, ICC, IHC, WB
AF7579
Species: Hu
Applications: CyTOF-ready, Flow, ICC, IHC, WB
AF3667
Species: Hu, Mu
Applications: Dual ISH-IHC, ICC, IHC, Simple Western, WB
NBP1-81838
Species: Hu
Applications: IHC,  IHC-P, WB
NBP2-33855PEP
Species: Hu
Applications: AC

Publications for Aminopeptidase N/CD13 Recombinant Protein Antigen (NBP2-33855PEP) (0)

There are no publications for Aminopeptidase N/CD13 Recombinant Protein Antigen (NBP2-33855PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Aminopeptidase N/CD13 Recombinant Protein Antigen (NBP2-33855PEP) (0)

There are no reviews for Aminopeptidase N/CD13 Recombinant Protein Antigen (NBP2-33855PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Aminopeptidase N/CD13 Recombinant Protein Antigen (NBP2-33855PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Aminopeptidase N/CD13 Products

Research Areas for Aminopeptidase N/CD13 Recombinant Protein Antigen (NBP2-33855PEP)

Find related products by research area.

Blogs on Aminopeptidase N/CD13

There are no specific blogs for Aminopeptidase N/CD13, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Aminopeptidase N/CD13 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol ANPEP