Aminomethyltransferase Antibody

Images

 
Western Blot: Aminomethyltransferase Antibody [H00000275-B01P] - Analysis of AMT expression in human kidney.
Western Blot: Aminomethyltransferase Antibody [H00000275-B01P] - Analysis of AMT expression in transfected 293T cell line by AMT polyclonal antibody. Lane 1: AMT transfected lysate(31.9 KDa). Lane 2: Non-transfected ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Aminomethyltransferase Antibody Summary

Immunogen
AMT (AAH07546.1, 1 a.a. - 289 a.a.) full-length human protein. MESLVVGDIAELRPNQGTLSLFTNEAGGILDDLIVTNTSEGHLYVVSNAGCWEKDLALMQDKVRELQNQGRDVGLEVLDNALLALQGPTAAQVLQAGVADDLRKLPFMTSAVMEVFGVSGCRVTRCGYTGEDGVEISVPVAGAVHLATAILKNPEVKLAGLAARDSLRLEAGLCLYGNDIDEHTTPVEGSLSWTLGKRRRAAMDFPGAKVIVPQLKGRVQRRRVGLMCEGAPMRAHSPILNMEGTKIGTVTSGCPSPSLKKNVAMGYVPCEYSRPGTMLLVELPSGPCF
Specificity
AMT - aminomethyltransferase,
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
AMT
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Aminomethyltransferase Antibody

  • aminomethyltransferase
  • EC 2.1.2.10
  • GCE
  • GCSTaminomethyltransferase (glycine cleavage system protein T)
  • glycine cleavage system protein T
  • NKHmitochondrial

Background

The enzyme system for cleavage of glycine (glycine cleavage system; EC 2.1.2.10), which is confined to the mitochondria, is composed of 4 protein components: P protein (a pyridoxal phosphate-dependent glycine decarboxylase; MIM 238300), H protein (a lipoic acid-containing protein; MIM 238330), T protein (a tetrahydrofolate-requiring enzyme), and L protein (a lipoamide dehydrogenase; MIM 238331). Glycine encephalopathy (GCE; MIM 605899) may be due to a defect in any one of these enzymes.[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB300-605
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF952
Species: Hu
Applications: WB, IHC, IP, ELISA(Cap), ELISA(Det), ELISA(Sta)
NBP2-01693
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-32907
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
NBP1-69668
Species: Hu
Applications: WB
NBP2-07087
Species: Hu
H00001719-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
H00002166-M07
Species: Hu, Mu, Rt
Applications: WB, ELISA
NB100-858
Species: Hu, Mu, Rt, GP, Mk
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, PEP-ELISA, IHC-WhMt
NBP2-34390
Species: Hu
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP
NBP1-76917
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB110-89456
Species: Hu
Applications: WB, ELISA, IHC, IHC-Fr, IHC-P
366-6C/CF
Species: Hu
NBP1-78977
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-47415
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-15304
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
MAB1106
Species: Hu
Applications: WB, ELISA(Cap), ELISA(Det), ELISA(Sta)
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P

Publications for Aminomethyltransferase Antibody (H00000275-B01P) (0)

There are no publications for Aminomethyltransferase Antibody (H00000275-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Aminomethyltransferase Antibody (H00000275-B01P) (0)

There are no reviews for Aminomethyltransferase Antibody (H00000275-B01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Aminomethyltransferase Antibody (H00000275-B01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Aminomethyltransferase Products

Bioinformatics Tool for Aminomethyltransferase Antibody (H00000275-B01P)

Discover related pathways, diseases and genes to Aminomethyltransferase Antibody (H00000275-B01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Aminomethyltransferase Antibody (H00000275-B01P)

Discover more about diseases related to Aminomethyltransferase Antibody (H00000275-B01P).
 

Pathways for Aminomethyltransferase Antibody (H00000275-B01P)

View related products by pathway.

PTMs for Aminomethyltransferase Antibody (H00000275-B01P)

Learn more about PTMs related to Aminomethyltransferase Antibody (H00000275-B01P).

Blogs on Aminomethyltransferase

There are no specific blogs for Aminomethyltransferase, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Aminomethyltransferase Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol AMT
Entrez
Uniprot