ALS2CR3 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: ALS2CR3 Antibody [NBP2-55830] - Staining of human cell line U-2 OS shows localization to nucleoplasm & vesicles.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ALS2CR3 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: DEEEGITFQVQQPLEVEEKLSTSKPVTGIFLPPITSAGGPVTVATANPGKCLSCTNST
Specificity
Specificity of human ALS2CR3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TRAK2
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for ALS2CR3 Antibody

  • ALS2CR3GRIF1
  • CALS-C
  • GRIF-1
  • KIAA0549amyotrophic lateral sclerosis 2 (juvenile) chromosome region, candidate 3
  • OIP98Amyotrophic lateral sclerosis 2 chromosomal region candidate gene 3 protein
  • trafficking kinesin-binding protein 2
  • trafficking protein, kinesin binding 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-56761
Species: Hu, Rt, Po, Bv, Ca, Eq, Rb
Applications: WB
NBP1-59021
Species: Hu, Mu, Rt, Bv, Ca, Eq, GP, Rb, Ze
Applications: WB, IHC, IHC-P
NBP1-88982
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-58450
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87429
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-71771
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-66383
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87709
Species: Hu
Applications: IHC, IHC-P
NBP2-01317
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-90183
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-76816
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IF
NB100-56116
Species: Hu, Mu, Rt, Ge
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
AF640
Species: Mu
Applications: WB, IHC
NBP1-83213
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-37399
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
NB100-57493
Species: Hu, Mu
Applications: WB, IP
NBP1-89163
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-31381
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
H00002965-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, RNAi
NBP2-55830
Species: Hu
Applications: ICC/IF

Publications for ALS2CR3 Antibody (NBP2-55830) (0)

There are no publications for ALS2CR3 Antibody (NBP2-55830).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ALS2CR3 Antibody (NBP2-55830) (0)

There are no reviews for ALS2CR3 Antibody (NBP2-55830). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for ALS2CR3 Antibody (NBP2-55830) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional ALS2CR3 Products

Bioinformatics Tool for ALS2CR3 Antibody (NBP2-55830)

Discover related pathways, diseases and genes to ALS2CR3 Antibody (NBP2-55830). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ALS2CR3 Antibody (NBP2-55830)

Discover more about diseases related to ALS2CR3 Antibody (NBP2-55830).
 

Pathways for ALS2CR3 Antibody (NBP2-55830)

View related products by pathway.

PTMs for ALS2CR3 Antibody (NBP2-55830)

Learn more about PTMs related to ALS2CR3 Antibody (NBP2-55830).

Blogs on ALS2CR3

There are no specific blogs for ALS2CR3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ALS2CR3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TRAK2