alpha-Taxilin Antibody - BSA Free Summary
Description |
Novus Biologicals Rabbit alpha-Taxilin Antibody - BSA Free (NBP1-91662) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee. |
Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: RNDLNKRVQDLSAGGQGSLTDSGPERRPEGPGAQAPSSPRVTEAPCYPGAPSTE |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
TXLNA |
Purity |
Immunogen affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
- Immunohistochemistry 1:500 - 1:1000
- Immunohistochemistry-Paraffin 1:500 - 1:1000
- Western Blot 0.04-0.4 ug/ml
|
Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
Control Peptide |
|
Packaging, Storage & Formulations
Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer |
PBS (pH 7.2) and 40% Glycerol |
Preservative |
0.02% Sodium Azide |
Purity |
Immunogen affinity purified |
Alternate Names for alpha-Taxilin Antibody - BSA Free
Background
Alpha Taxilin may be involved in intracellular vesicle traffic and potentially in calcium-dependent exocytosis inneuroendocrine cells
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: BA
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Hu
Applications: BA
Species: Hu
Applications: BA
Species: Av, Hu, Mu, Rt
Applications: CyTOF-ready, Flow-IC, Flow, IHC, IHC-P, WB
Species: Mu
Applications: BA
Species: Hu
Applications: BA
Species: Hu
Applications: BA
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-Fr, WB
Species: Mu
Applications: ELISA
Species: Hu
Applications: ELISA
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: ELISA
Publications for alpha-Taxilin Antibody (NBP1-91662) (0)
There are no publications for alpha-Taxilin Antibody (NBP1-91662).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for alpha-Taxilin Antibody (NBP1-91662) (0)
There are no reviews for alpha-Taxilin Antibody (NBP1-91662).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for alpha-Taxilin Antibody (NBP1-91662). (Showing 1 - 1 of 1 FAQ).
-
I was wondering if I can order alpha-Taxilin antibody (NBP1-91662) with no glycerol in it?
- Unfortunately, NBP1-91662 is not available in a glycerol free format.
Secondary Antibodies
| |
Isotype Controls
|
Additional alpha-Taxilin Products
Blogs on alpha-Taxilin