alpha-Taxilin Antibody - BSA Free

Immunohistochemistry-Paraffin: alpha-Taxilin Antibody [NBP1-91662] - Analysis in human testis and heart muscle tissues. Corresponding TXLNA RNA-seq data are presented for the same tissues.

Western Blot: alpha-Taxilin Antibody [NBP1-91662] - Analysis in human cell line HELA.

Immunocytochemistry/Immunofluorescence: alpha-Taxilin Antibody [NBP1-91662] - Staining of human cell line U-2 OS shows localization to nucleoplasm & cytosol. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: alpha-Taxilin Antibody [NBP1-91662] - Staining of human testis shows high expression.

Immunohistochemistry-Paraffin: alpha-Taxilin Antibody [NBP1-91662] - Staining of human Fallopian tube shows moderate cytoplasmic/membranous positivity in glandular cells.

Immunohistochemistry-Paraffin: alpha-Taxilin Antibody [NBP1-91662] - Staining of human heart muscle shows no positivity in cardiomyocytes as expected.

Immunohistochemistry-Paraffin: alpha-Taxilin Antibody [NBP1-91662] - Staining of human skeletal muscle shows low cytoplasmic positivity in myocytes as expected.

Immunohistochemistry-Paraffin: alpha-Taxilin Antibody [NBP1-91662] - Staining of human skin shows weak to moderate cytoplasmic positivity in squamous epithelial cells.

Analysis in human cell line HEL.

Analysis in human testis and heart muscle tissues using NBP1-91662 antibody. Corresponding TXLNA RNA-seq data are presented for the same tissues.

Staining of human testis shows moderate cytoplasmic positivity in cells in seminiferous ducts.

Staining of human cell line U-2 OS shows localization to nucleoplasm & cytosol.

• Reactivity: Hu
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

alpha-Taxilin Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit alpha-Taxilin Antibody - BSA Free (NBP1-91662) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: RNDLNKRVQDLSAGGQGSLTDSGPERRPEGPGAQAPSSPRVTEAPCYPGAPSTE
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TXLNA
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  alpha-Taxilin Protein (NBP1-91662PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for alpha-Taxilin Antibody - BSA Free

• alphaTaxilin
• alpha-Taxilin
• DKFZp451J0118
• IL14
• IL-14
• interleukin 14
• MGC118870
• MGC118871
• RP4-622L5.4
• taxilin alpha
• TXLN
• TXLNA

Background

Alpha Taxilin may be involved in intracellular vesicle traffic and potentially in calcium-dependent exocytosis inneuroendocrine cells

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

FAQs for alpha-Taxilin Antibody (NBP1-91662). (Showing 1 - 1 of 1 FAQ).

1. I was wondering if I can order alpha-Taxilin antibody (NBP1-91662) with no glycerol in it?
   • Unfortunately, NBP1-91662 is not available in a glycerol free format.

Bioinformatics

• Gene Symbol: TXLNA
• Entrez:
  • 200081(Human)
• Uniprot:
  • P40222()