Alpha Actinin 4 Antibody (1E10.)

Images

 
Sandwich ELISA: Alpha Actinin 4 Antibody (1E10) [H00000081-M02] - Detection limit for recombinant GST tagged ACTN4 is 0.3 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
1E10.
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Alpha Actinin 4 Antibody (1E10.) Summary

Immunogen
ACTN4 (NP_004915, 592 a.a. - 701 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. KEAQRIAESNHIKLSGSNPYTTVTPQIINSKWEKVQQLVPKRDHALLEEQSKQQSNEHLRRQFASQANVVGPWIQTKMEEIGRISIEMNGTLEDQLSHLKQYERSIVDYK
Isotype
IgG2a
Clonality
Monoclonal
Host
Mouse
Gene
ACTN4
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
It has been used for ELISA and WB.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Alpha Actinin 4 Antibody (1E10.)

  • actinin alpha4 isoform
  • actinin, alpha 4
  • ACTININ-4
  • alpha-actinin-4
  • DKFZp686K23158
  • F-actin cross-linking protein
  • focal segmental glomerulosclerosis 1
  • FSGS
  • FSGS1
  • Non-muscle alpha-actinin 4

Background

Alpha actinins belong to the spectrin gene superfamily which represents a diverse group of cytoskeletal proteins, including the alpha and beta spectrins and dystrophins. Alpha actinin is an actin-binding protein with multiple roles in different cell types. In nonmuscle cells, the cytoskeletal isoform is found along microfilament bundles and adherens-type junctions, where it is involved in binding actin to the membrane. In contrast, skeletal, cardiac, and smooth muscle isoforms are localized to the Z-disc and analogous dense bodies, where they help anchor the myofibrillar actin filaments. This gene encodes a nonmuscle, alpha actinin isoform which is concentrated in the cytoplasm, and thought to be involved in metastatic processes. Mutations in this gene have been associated with focal and segmental glomerulosclerosis.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF3159
Species: Mu
Applications: WB, IHC
NBP1-32797
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-39100
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
AF1638
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC
H00003845-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IP
NB110-60011
Species: Hu, Mu
Applications: WB, Simple Western, IHC, IHC-Fr, IHC-P, IP
NBP1-48251
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
MAB1228
Species: Hu
Applications: Flow, IHC, IP, CyTOF-ready
NB100-417
Species: Hu, Mu, Rt, Ca, Pl
Applications: WB, Simple Western, ChIP, ELISA, Flow, GS, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-90626
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-00142
Species: Hu, Mu
Applications: WB, IP, PEP-ELISA
AF1513
Species: Mu
Applications: WB, Simple Western, Flow, IHC, IP, CyTOF-ready
H00009771-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-89917
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE

Publications for Alpha Actinin 4 Antibody (H00000081-M02) (0)

There are no publications for Alpha Actinin 4 Antibody (H00000081-M02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Alpha Actinin 4 Antibody (H00000081-M02) (0)

There are no reviews for Alpha Actinin 4 Antibody (H00000081-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Alpha Actinin 4 Antibody (H00000081-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Alpha Actinin 4 Products

Bioinformatics Tool for Alpha Actinin 4 Antibody (H00000081-M02)

Discover related pathways, diseases and genes to Alpha Actinin 4 Antibody (H00000081-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Alpha Actinin 4 Antibody (H00000081-M02)

Discover more about diseases related to Alpha Actinin 4 Antibody (H00000081-M02).
 

Pathways for Alpha Actinin 4 Antibody (H00000081-M02)

View related products by pathway.

PTMs for Alpha Actinin 4 Antibody (H00000081-M02)

Learn more about PTMs related to Alpha Actinin 4 Antibody (H00000081-M02).

Blogs on Alpha Actinin 4

There are no specific blogs for Alpha Actinin 4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Alpha Actinin 4 Antibody (1E10.) and receive a gift card or discount.

Bioinformatics

Gene Symbol ACTN4
Uniprot