alpha-Actinin 1 Recombinant Protein Antigen

Images

 
There are currently no images for alpha-Actinin 1 Recombinant Protein Antigen (NBP1-85791PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

alpha-Actinin 1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ACTN1.

Source: E. coli

Amino Acid Sequence: SAKEGLLLWCQRKTAPYKNVNIQNFHISWKDGLGFCALIHRHRPELIDYGKLRKDDPLTNLNTAFDVAEKYLDIPKMLDAEDIVGTARPDEKAIMTYVSSFYHAFSGAQKAETAANRICKV

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
ACTN1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-85791.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
31 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for alpha-Actinin 1 Recombinant Protein Antigen

  • actinin 1 smooth muscle
  • actinin, alpha 1
  • ACTN1
  • alpha Actinin 1
  • alphaActinin 1
  • alpha-Actinin 1
  • Alpha-actinin cytoskeletal isoform
  • alpha-actinin-1
  • BDPLT15
  • F-actin cross-linking protein
  • FLJ40884
  • FLJ54432
  • Non-muscle alpha-actinin-1

Background

Alpha Actinin is an actin binding protein present in both muscle and non-muscle cells. It has a molecular weight of 100,000 daltons and forms dimers in solution. In normal skeletal muscle alpha actinin is associated with the z-discs that define muscle sarcomeres. In smooth muscle alpha actinin has been detected in dense bodies and plaques characteristic of the tissue. Immunofluorescent labeling of a large variety of cells using antibody to alpha actinin reveals extensive association of the proteins with actin containing stress fibers and in particular with their membrane bound termini.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00000081-M01
Species: Hu, Pm, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
AF2685
Species: Hu
Applications: IHC, Simple Western, WB
NBP1-32462
Species: Hu, Mu, Po, Rt, Ze
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-49533
Species: Hu, Mu, Pl, Rt
Applications: Flow-IC, Flow, ICC/IF, IHC,  IHC-P, KD, WB
NBP1-91258
Species: Bv, Ca, Eq, Fe, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, Simple Western, WB
NBP1-84443
Species: Hu
Applications: IHC,  IHC-P, WB
AF796
Species: Mu
Applications: AdBlk, IHC, WB
AF1730
Species: Hu
Applications: AdBlk, CyTOF-ready, Flow, ICC
NBP2-15971
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, KO, WB
NBP1-91941
Species: Hu
Applications: IHC,  IHC-P, WB
MAB6896
Species: Hu, Mu, Rt
Applications: IHC, Simple Western, WB
MAB3595
Species: Hu
Applications: CyTOF-ready, Flow, Simple Western, WB
NBP1-80833
Species: Hu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
MAB4467
Species: Hu
Applications: IHC, KO, Simple Western, WB
NB100-615
Species: Hu, Mu, Rt, Sh
Applications: Flow, IB, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
236-EG
Species: Hu
Applications: BA
NBP2-22203
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, WB
AF1230
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
NBP2-41263
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP1-85791PEP
Species: Hu
Applications: AC

Publications for alpha-Actinin 1 Recombinant Protein Antigen (NBP1-85791PEP) (0)

There are no publications for alpha-Actinin 1 Recombinant Protein Antigen (NBP1-85791PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for alpha-Actinin 1 Recombinant Protein Antigen (NBP1-85791PEP) (0)

There are no reviews for alpha-Actinin 1 Recombinant Protein Antigen (NBP1-85791PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for alpha-Actinin 1 Recombinant Protein Antigen (NBP1-85791PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional alpha-Actinin 1 Products

Research Areas for alpha-Actinin 1 Recombinant Protein Antigen (NBP1-85791PEP)

Find related products by research area.

Blogs on alpha-Actinin 1

There are no specific blogs for alpha-Actinin 1, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our alpha-Actinin 1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol ACTN1