ALMS1 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: ALMS1 Antibody [NBP1-83015] - Immunofluorescent staining of human cell line A-431 shows localization to cytosol.
Immunohistochemistry-Paraffin: ALMS1 Antibody [NBP1-83015] - Staining of human testis shows strong cytoplasmic positivity in cells in seminiferous ducts.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ALMS1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:DFFQHHPDKHREHMCLPLPYQNMDKTKTDYTRIKSLSINVNLGNKEVMDTTKSQVRDYPKHNGQISDPQRDQKVTP
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ALMS1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ALMS1 Protein (NBP1-83015PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ALMS1 Antibody

  • Alstrom syndrome 1
  • Alstrom syndrome protein 1
  • DKFZp686A118
  • DKFZp686D1828
  • KIAA0328ALSS

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-42216
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF8064
Species: Hu
Applications: WB, IHC, ICC
NBP2-27192
Species: Hu, Mu, Bv, Ca, Ch, Eq, Pm
Applications: WB, IHC-P
E2-745
Species: Hu
NBP2-03396
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB5175
Species: Mu
Applications: WB, IHC
NBP1-83385
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89324
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00008086-M02
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC-P
NBP2-14617
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-87832
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00029956-M01A
Species: Hu, Mu
Applications: WB, ELISA, IHC-P
NBP2-45867
Species: Hu
Applications: WB, Flow, IHC
NBP2-16216
Species: Hu, Mu
Applications: WB
NBP1-58268
Species: Hu
Applications: WB, IHC, IHC-P

Publications for ALMS1 Antibody (NBP1-83015) (0)

There are no publications for ALMS1 Antibody (NBP1-83015).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ALMS1 Antibody (NBP1-83015) (0)

There are no reviews for ALMS1 Antibody (NBP1-83015). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for ALMS1 Antibody (NBP1-83015) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ALMS1 Products

ALMS1 NBP1-83015

Bioinformatics Tool for ALMS1 Antibody (NBP1-83015)

Discover related pathways, diseases and genes to ALMS1 Antibody (NBP1-83015). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ALMS1 Antibody (NBP1-83015)

Discover more about diseases related to ALMS1 Antibody (NBP1-83015).
 

Pathways for ALMS1 Antibody (NBP1-83015)

View related products by pathway.

PTMs for ALMS1 Antibody (NBP1-83015)

Learn more about PTMs related to ALMS1 Antibody (NBP1-83015).
 

Research Areas for ALMS1 Antibody (NBP1-83015)

Find related products by research area.

Blogs on ALMS1

There are no specific blogs for ALMS1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ALMS1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ALMS1