ALMS1 Antibody


Immunocytochemistry/ Immunofluorescence: ALMS1 Antibody [NBP1-83015] - Immunofluorescent staining of human cell line A-431 shows localization to cytosol.
Immunohistochemistry-Paraffin: ALMS1 Antibody [NBP1-83015] - Staining in human testis and skeletal muscle tissues using anti-ALMS1 antibody. Corresponding ALMS1 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: ALMS1 Antibody [NBP1-83015] - Staining of human skeletal muscle shows low expression as expected.
Immunohistochemistry-Paraffin: ALMS1 Antibody [NBP1-83015] - Staining of human testis shows high expression.

Product Details

Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P

Order Details

ALMS1 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: DFFQHHPDKHREHMCLPLPYQNMDKTKTDYTRIKSLSINVNLGNKEVMDTTKSQVRDYPKHNGQISDPQRDQKVTP
Specificity of human ALMS1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ALMS1 Protein (NBP1-83015PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for ALMS1 Antibody

  • Alstrom syndrome 1
  • Alstrom syndrome protein 1
  • DKFZp686A118
  • DKFZp686D1828
  • KIAA0328ALSS


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Bv, Ca, Ch, Eq, Pm
Applications: WB, IHC-P
Species: Hu
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Mu
Applications: WB, IHC
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Flow, IHC
Species: Hu, Mu
Applications: WB
Species: Hu
Applications: WB, IHC, IHC-P

Publications for ALMS1 Antibody (NBP1-83015) (0)

There are no publications for ALMS1 Antibody (NBP1-83015).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ALMS1 Antibody (NBP1-83015) (0)

There are no reviews for ALMS1 Antibody (NBP1-83015). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for ALMS1 Antibody (NBP1-83015) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional ALMS1 Products

ALMS1 NBP1-83015

Bioinformatics Tool for ALMS1 Antibody (NBP1-83015)

Discover related pathways, diseases and genes to ALMS1 Antibody (NBP1-83015). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ALMS1 Antibody (NBP1-83015)

Discover more about diseases related to ALMS1 Antibody (NBP1-83015).

Pathways for ALMS1 Antibody (NBP1-83015)

View related products by pathway.

PTMs for ALMS1 Antibody (NBP1-83015)

Learn more about PTMs related to ALMS1 Antibody (NBP1-83015).

Research Areas for ALMS1 Antibody (NBP1-83015)

Find related products by research area.

Blogs on ALMS1

There are no specific blogs for ALMS1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our ALMS1 Antibody and receive a gift card or discount.


Gene Symbol ALMS1