DP2 Antibody

Images

 
Western Blot: DP2 Antibody [NBP2-88806] - WB Suggested Anti-TFDP2 Antibody Titration: 1.25ug/ml. Positive Control: Jurkat cell lysateTFDP2 is strongly supported by BioGPS gene expression data to be expressed in Human ...read more
Immunohistochemistry: DP2 Antibody [NBP2-88806] - Human kidney

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

DP2 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of human DP2. Peptide sequence: MIISTPQRLTSSGSVLIGSPYTPAPAMVTQTHIAEATGWVPGDRKRARKF The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
TFDP2
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Protein A purified

Alternate Names for DP2 Antibody

  • DKFZp313O196
  • DP2Dp-2
  • E2F dimerization partner 2
  • FLJ39131
  • transcription factor Dp-2 (E2F dimerization partner 2)
  • transcription factor Dp-2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP3-17064
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NBP2-92787
Species: Hu, Mu
Applications: IHC, IHC-P, WB
NBP2-73850
Species: Hu, Mu, Rt
Applications: CyTOF-ready, Flow, IHC, WB
MAB9080
Species: Hu
Applications: WB
NBP1-76755
Species: Gp, Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NBP1-87311
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
NBP2-45880
Species: Hu, Mu, Rt
Applications: IF, IHC, IHC-P, WB
NBP1-00178
Species: Hu, Mu, Sh
Applications: Flow, ICC/IF, IHC, IHC-Fr, PEP-ELISA, WB
MAB6487
Species: Hu
Applications: ICC, WB
NBP1-79280
Species: Hu, Mu
Applications: IHC, IHC-P, WB
NBP2-67899
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
NBP2-53380
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
NB100-91662
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP1-26616
Species: Hu
Applications: IP, WB
NBP1-21374
Species: Hu
Applications: IHC, IHC-P, IP, KD, WB
NBP2-66858
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Hrk
WBC013
Species: Hu
Applications: WB
NBP2-29463
Species: Pm, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB

Publications for DP2 Antibody (NBP2-88806) (0)

There are no publications for DP2 Antibody (NBP2-88806).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DP2 Antibody (NBP2-88806) (0)

There are no reviews for DP2 Antibody (NBP2-88806). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for DP2 Antibody (NBP2-88806) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional DP2 Products

Bioinformatics Tool for DP2 Antibody (NBP2-88806)

Discover related pathways, diseases and genes to DP2 Antibody (NBP2-88806). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DP2 Antibody (NBP2-88806)

Discover more about diseases related to DP2 Antibody (NBP2-88806).
 

Pathways for DP2 Antibody (NBP2-88806)

View related products by pathway.

PTMs for DP2 Antibody (NBP2-88806)

Learn more about PTMs related to DP2 Antibody (NBP2-88806).
 

Research Areas for DP2 Antibody (NBP2-88806)

Find related products by research area.

Blogs on DP2

There are no specific blogs for DP2, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DP2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TFDP2