DP2 Antibody

Western Blot: DP2 Antibody [NBP2-88806] - WB Suggested Anti-TFDP2 Antibody Titration: 1.25ug/ml. Positive Control: Jurkat cell lysateTFDP2 is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells

Immunohistochemistry: DP2 Antibody [NBP2-88806] - Human kidney

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Concentration: 1 mg/ml

DP2 Antibody Summary

• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of human DP2. Peptide sequence: MIISTPQRLTSSGSVLIGSPYTPAPAMVTQTHIAEATGWVPGDRKRARKF The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TFDP2
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 1 mg/ml
• Purity: Protein A purified

Alternate Names for DP2 Antibody

• DKFZp313O196
• DP2Dp-2
• E2F dimerization partner 2
• FLJ39131
• transcription factor Dp-2 (E2F dimerization partner 2)
• transcription factor Dp-2

Background

DP2 can stimulate E2F-dependent transcription. Binds DNA cooperatively with E2F family members through the E2 recognition site, 5'-TTTC[CG]CGC-3', found in the promoter region of a number of genes whose products are involved in cell cycle regulation or in DNA replication. The DP2/E2F complex functions in the control of cell-cycle progression from G1 to S phase. The E2F-1/DP complex appears to mediate both cell proliferation and apoptosis.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: TFDP2