ALK-7/Activin Receptor Type 1C Antibody

Images

 
Immunohistochemistry-Paraffin: ALK-7/Activin Receptor Type 1C Antibody [NBP1-90253] - Staining of human prostate shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ALK-7/Activin Receptor Type 1C Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:ELSPGLKCVCLLCDSSNFTCQTEGACWASVMLTNGKEQVIKSCVSLPELNAQVFCHSSNNVTKTECCFTDFCNNITLHL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (96%), Rat (96%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ACVR1C
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
ALK-7/Activin Receptor Type 1C Protein (NBP1-90253PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ALK-7/Activin Receptor Type 1C Antibody

  • activin A receptor, type IC
  • Activin receptor type IC
  • activin receptor type-1C
  • Activin receptor-like kinase 7
  • Activin RIC
  • ACTR-IC
  • ACVR1C
  • ACVRLK7
  • ALK7
  • ALK-7
  • ALK7ALK-7
  • EC 2.7.11
  • EC 2.7.11.30

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF1477
Species: Mu
Applications: WB, IHC, Block
AF3797
Species: Hu, Mu
Applications: WB, Simple Western, ChIP, ICC
NBP1-77836
Species: Hu, Mu, Rt, Po, Bv, Ch, Xp, Ze
Applications: WB, ELISA, Flow, IHC, IHC-P
AF3025
Species: Hu
Applications: WB, ICC
AF8221
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
NB100-56708
Species: Hu, Mu, Rt, Po, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready
AF958
Species: Hu, Mu
Applications: WB, IHC, ICC
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
AF4210
Species: Hu
Applications: WB, IHC
NBP1-33500
Species: Mu, Rt
Applications: WB, IHC, IHC-Fr
NB100-1598
Species: Hu, Mu
Applications: WB, Flow, ICC/IF
NBP1-87518
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
AF2097
Species: Hu
Applications: WB, ChIP, ICC
MAB6937
Species: Hu
Applications: WB

Publications for ALK-7/Activin Receptor Type 1C Antibody (NBP1-90253) (0)

There are no publications for ALK-7/Activin Receptor Type 1C Antibody (NBP1-90253).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ALK-7/Activin Receptor Type 1C Antibody (NBP1-90253) (0)

There are no reviews for ALK-7/Activin Receptor Type 1C Antibody (NBP1-90253). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for ALK-7/Activin Receptor Type 1C Antibody (NBP1-90253) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ALK-7/Activin Receptor Type 1C Products

Bioinformatics Tool for ALK-7/Activin Receptor Type 1C Antibody (NBP1-90253)

Discover related pathways, diseases and genes to ALK-7/Activin Receptor Type 1C Antibody (NBP1-90253). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ALK-7/Activin Receptor Type 1C Antibody (NBP1-90253)

Discover more about diseases related to ALK-7/Activin Receptor Type 1C Antibody (NBP1-90253).
 

Pathways for ALK-7/Activin Receptor Type 1C Antibody (NBP1-90253)

View related products by pathway.

PTMs for ALK-7/Activin Receptor Type 1C Antibody (NBP1-90253)

Learn more about PTMs related to ALK-7/Activin Receptor Type 1C Antibody (NBP1-90253).
 

Research Areas for ALK-7/Activin Receptor Type 1C Antibody (NBP1-90253)

Find related products by research area.

Blogs on ALK-7/Activin Receptor Type 1C

There are no specific blogs for ALK-7/Activin Receptor Type 1C, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ALK-7/Activin Receptor Type 1C Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ACVR1C
Entrez