Aldolase B Antibody - BSA Free

Western Blot: Aldolase B Antibody [NBP1-87494] - Analysis in human kidney tissue.

Immunohistochemistry-Paraffin: Aldolase B Antibody [NBP1-87494] - Staining in human kidney and tonsil tissues . Corresponding ALDOB RNA-seq data are presented for the same tissues.

Western Blot: Aldolase B Antibody [NBP1-87494] - Lane 1: Marker [kDa] 206, 113, 82, 49, 32, 26, 18. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human cell line A-431 Lane 5: Human liver tissue

Immunohistochemistry-Paraffin: Aldolase B Antibody [NBP1-87494] - Staining of human kidney shows moderate cytoplasmic positivity in cells in proximal tubules.

Immunohistochemistry-Paraffin: Aldolase B Antibody [NBP1-87494] - Staining of human liver shows moderate to strong cytoplasmic positivity in hepatocytes.

Immunohistochemistry-Paraffin: Aldolase B Antibody [NBP1-87494] - Staining of human small intestine shows moderate cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: Aldolase B Antibody [NBP1-87494] - Staining of human tonsil shows no positivity in lymphoid cells as expected.

• Reactivity: Hu, Mu, Rt
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Aldolase B Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Aldolase B Antibody - BSA Free (NBP1-87494) is a polyclonal antibody validated for use in IHC and WB. Anti-Aldolase B Antibody: Cited in 2 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: KPNMVTAGHACTKKYTPEQVAMATVTALHRTVPAAVPGICFLSGGMSEEDATLNLNAINLCPLPKPWKLSFSYGRALQASALAAWGGKAANKEATQEAFMKRAMANCQAAKGQYVHTGSSGAA
• Predicted Species: Mouse (97%), Rat (96%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ALDOB
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:200-1:500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  Aldolase B Protein (NBP1-87494PEP)

Reactivity Notes

Reactivity reported in scientific literature (PMID: 21307348).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Aldolase B Antibody - BSA Free

• ALDO2
• aldolase B, fructose-bisphosphate
• EC 4.1.2.13
• fructose-bisphosphatase
• fructose-bisphosphate aldolase B

Background

Fructose-1,6-bisphosphate aldolase (EC 4.1.2.13 ) is a tetrameric glycolytic enzyme that catalyzes the reversible conversion of fructose-1,6-bisphosphate to glyceraldehyde 3-phosphate and dihydroxyacetone phosphate. Vertebrates have 3 aldolase isozymes which are distinguished by their electrophoretic and catalytic properties. Differences indicate that aldolases A, B, and C are distinct proteins, the products of a family of related 'housekeeping' genes exhibiting developmentally regulated expression of the different isozymes. The developing embryo produces aldolase A, which is produced in even greater amounts in adult muscle where it can be as much as 5% of total cellular protein. In adult liver, kidney and intestine, aldolase A expression is repressed and aldolase B is produced. In brain and other nervous tissue, aldolase A and C are expressed about equally. There is a high degree of homology between aldolase A and C. Defects in ALDOB cause hereditary fructose intolerance.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Aldolase B Antibody (NBP1-87494)(2)

Publications using NBP1-87494

• Kampf C, Mardinoglu A, Fagerberg L et al. The human liver-specific proteome defined by transcriptomics and antibody-based profiling. FASEB J 2014-07-01 [PMID: 24648543]
• Merkulova M, Hurtado-Lorenzo A, Hosokawa H et al. Aldolase directly interacts with ARNO and modulates cell morphology and acidic vesicle distribution. Am J Physiol Cell Physiol 2011-06-01 [PMID: 21307348]

Bioinformatics

• Gene Symbol: ALDOB