Aldolase B Antibody

Images

 
Western Blot: Aldolase B Antibody [NBP1-87494] - Lane 1: Marker [kDa] 206, 113, 82, 49, 32, 26, 18. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human cell line A-431 Lane 5: Human ...read more
Immunohistochemistry-Paraffin: Aldolase B Antibody [NBP1-87494] - Staining of human liver shows strong cytoplasmic and nuclear positivity in hepatocytes.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Aldolase B Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:KPNMVTAGHACTKKYTPEQVAMATVTALHRTVPAAVPGICFLSGGMSEEDATLNLNAINLCPLPKPWKLSFSYGRALQASALAAWGGKAANKEATQEAFMKRAMANCQAAKGQYVHTGSSGAA
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (97%), Rat (96%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ALDOB
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Aldolase B Protein (NBP1-87494PEP)
Publications
Read Publications using NBP1-87494.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 21307348)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Aldolase B Antibody

  • ALDO2
  • aldolase B, fructose-bisphosphate
  • EC 4.1.2.13
  • fructose-bisphosphatase
  • fructose-bisphosphate aldolase B

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-57614
Species: Hu
Applications: ICC/IF
NBP1-59448
Species: Hu
Applications: WB
NBP2-30949
Species: Hu
Applications: IHC, IHC-P
AF5869
Species: Hu, Mu
Applications: WB, Simple Western, IHC, IP, ICC
NBP1-97512
Species: Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-90954
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-49365
Species: Hu
Applications: ICC/IF, IHC
NBP1-47974
Species: Hu, Rt, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81293
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB110-99585
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ICC/IF
NB100-56605
Species: Av, Bv, Sh
Applications: WB
NBP1-87401
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88654
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87488
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00000259-D01P
Species: Hu, Mu, Rt
Applications: WB
NB600-610
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, IP
NB200-310
Species: Hu, Mu, Rt, Mk
Applications: WB, ChIP, IP, IF
NBP2-14873
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for Aldolase B Antibody (NBP1-87494)(2)

Reviews for Aldolase B Antibody (NBP1-87494) (0)

There are no reviews for Aldolase B Antibody (NBP1-87494). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Aldolase B Antibody (NBP1-87494) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Aldolase B Products

Bioinformatics Tool for Aldolase B Antibody (NBP1-87494)

Discover related pathways, diseases and genes to Aldolase B Antibody (NBP1-87494). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Aldolase B Antibody (NBP1-87494)

Discover more about diseases related to Aldolase B Antibody (NBP1-87494).
 

Pathways for Aldolase B Antibody (NBP1-87494)

View related products by pathway.

PTMs for Aldolase B Antibody (NBP1-87494)

Learn more about PTMs related to Aldolase B Antibody (NBP1-87494).
 

Research Areas for Aldolase B Antibody (NBP1-87494)

Find related products by research area.

Blogs on Aldolase B

There are no specific blogs for Aldolase B, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Aldolase B Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ALDOB