alcohol dehydrogenase 4 Antibody


Western Blot: alcohol dehydrogenase 4 Antibody [NBP1-53173] - Titration: 1.25ug/ml Positive Control: Fetal liver cell lysate.
Immunohistochemistry-Paraffin: alcohol dehydrogenase 4 Antibody [NBP1-53173] - Human kidney Tissue, antibody concentration 4-8ug/ml. Cells with positive label: renal corpuscle cells (indicated with arrows) 400X more

Product Details

Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P

Order Details

alcohol dehydrogenase 4 Antibody Summary

Synthetic peptides corresponding to ADH4(alcohol dehydrogenase 4 (class II), pi polypeptide) The peptide sequence was selected from the middle region of ADH4. Peptide sequence NSEKFVKAKALGATDCLNPRDLHKPIQEVIIELTKGGVDFALDCAGGSET.
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
Application Notes
This is a rabbit polyclonal antibody against ADH4 and was validated on Western Blot and immunohistochemistry-P

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Protein A purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for alcohol dehydrogenase 4 Antibody

  • ADH-2
  • alcohol dehydrogenase 4 (class II), pi polypeptide
  • alcohol dehydrogenase 4
  • Alcohol dehydrogenase class II pi chain
  • aldehyde reductase
  • EC 1.1.1
  • EC


ADH4, class II alcohol dehydrogenase 4 pi subunit, which is a member of the alcohol dehydrogenase family. Members of this enzyme family metabolize a wide variety of substrates, including ethanol, retinol, other aliphatic alcohols, hydroxysteroids, and lipid peroxidation products. Class II alcohol dehydrogenase is a homodimer composed of 2 pi subunits. It exhibits a high activity for oxidation of long-chain aliphatic alcohols and aromatic alcohols and is less sensitive to pyrazole.This gene encodes class II alcohol dehydrogenase 4 pi subunit, which is a member of the alcohol dehydrogenase family. Members of this enzyme family metabolize a wide variety of substrates, including ethanol, retinol, other aliphatic alcohols, hydroxysteroids, and lipid peroxidation products. Class II alcohol dehydrogenase is a homodimer composed of 2 pi subunits. It exhibits a high activity for oxidation of long-chain aliphatic alcohols and aromatic alcohols and is less sensitive to pyrazole. This gene is localized to chromosome 4 in the cluster of alcohol dehydrogenase genes.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Pm
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
Species: Hu, Mu, Rt, Ma
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Ha, Mk, Pm, Rb
Applications: IHC-P, ICC
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
Species: Hu, Fi, Ze
Applications: WB, ICC/IF, IHC
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC

Publications for alcohol dehydrogenase 4 Antibody (NBP1-53173) (0)

There are no publications for alcohol dehydrogenase 4 Antibody (NBP1-53173).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for alcohol dehydrogenase 4 Antibody (NBP1-53173) (0)

There are no reviews for alcohol dehydrogenase 4 Antibody (NBP1-53173). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for alcohol dehydrogenase 4 Antibody (NBP1-53173) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional alcohol dehydrogenase 4 Products

Bioinformatics Tool for alcohol dehydrogenase 4 Antibody (NBP1-53173)

Discover related pathways, diseases and genes to alcohol dehydrogenase 4 Antibody (NBP1-53173). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for alcohol dehydrogenase 4 Antibody (NBP1-53173)

Discover more about diseases related to alcohol dehydrogenase 4 Antibody (NBP1-53173).

Pathways for alcohol dehydrogenase 4 Antibody (NBP1-53173)

View related products by pathway.

PTMs for alcohol dehydrogenase 4 Antibody (NBP1-53173)

Learn more about PTMs related to alcohol dehydrogenase 4 Antibody (NBP1-53173).

Research Areas for alcohol dehydrogenase 4 Antibody (NBP1-53173)

Find related products by research area.

Blogs on alcohol dehydrogenase 4

There are no specific blogs for alcohol dehydrogenase 4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our alcohol dehydrogenase 4 Antibody and receive a gift card or discount.


Gene Symbol ADH4