alcohol dehydrogenase 1A Antibody - BSA Free

Western Blot: alcohol dehydrogenase 1A Antibody [NBP3-10788] - Western blot analysis of alcohol dehydrogenase 1A in Fetal Liver lysates. Antibody dilution at 1.0ug/ml

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

alcohol dehydrogenase 1A Antibody - BSA Free Summary

• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human alcohol dehydrogenase 1A. Peptide sequence PESNYCLKNDVSNPQGTLQDGTSRFTCRRKPIHHFLGISTFSQYTVVDEN
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ADH1A
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 41 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for alcohol dehydrogenase 1A Antibody - BSA Free

• ADH, alpha subunit
• ADH1alcohol dehydrogenase 1A
• alcohol dehydrogenase 1 (class I), alpha polypeptide
• alcohol dehydrogenase 1A (class I), alpha polypeptide
• Alcohol dehydrogenase subunit alpha
• aldehyde reductase
• EC 1.1.1
• EC 1.1.1.1

Background

This gene encodes a member of the alcohol dehydrogenase family. The encoded protein is the alpha subunit of class I alcohol dehydrogenase, which consists of several homo- and heterodimers of alpha, beta and gamma subunits. Alcohol dehydrogenases catalyze the oxidation of alcohols to aldehydes. This gene is active in the liver in early fetal life but only weakly active in adult liver. This gene is found in a cluster with six additional alcohol dehydrogenase genes, including those encoding the beta and gamma subunits, on the long arm of chromosome 4. Mutations in this gene may contribute to variation in certain personality traits and substance dependence.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ADH1A