alcohol dehydrogenase 1A Antibody

Images

 
Western Blot: alcohol dehydrogenase 1A Antibody [NBP1-57672] - Human Liver cell lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity Hu, Rt, Bv, Ca, Eq, GP, Rb, Ye, ZeSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

alcohol dehydrogenase 1A Antibody Summary

Immunogen
Synthetic peptides corresponding to ADH1A(alcohol dehydrogenase 1A (class I), alpha polypeptide) The peptide sequence was selected from the N terminal of ADH1A. Peptide sequence NYCLKNDVSNPQGTLQDGTSRFTCRRKPIHHFLGISTFSQYTVVDENAVA.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ADH1A
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against ADH1A and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS & 2% Sucrose.
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for alcohol dehydrogenase 1A Antibody

  • ADH, alpha subunit
  • ADH1alcohol dehydrogenase 1A
  • alcohol dehydrogenase 1 (class I), alpha polypeptide
  • alcohol dehydrogenase 1A (class I), alpha polypeptide
  • Alcohol dehydrogenase subunit alpha
  • aldehyde reductase
  • EC 1.1.1
  • EC 1.1.1.1

Background

ADH1A is class I alcohol dehydrogenase, alpha subunit, which is a member of the alcohol dehydrogenase family. Members of this enzyme family metabolize a wide variety of substrates, including ethanol, retinol, other aliphatic alcohols, hydroxysteroids, and lipid peroxidation products. Class I alcohol dehydrogenase, consisting of several homo- and heterodimers of alpha, beta, and gamma subunits, exhibits high activity for ethanol oxidation and plays a major role in ethanol catabolism.This gene encodes class I alcohol dehydrogenase, alpha subunit, which is a member of the alcohol dehydrogenase family. Members of this enzyme family metabolize a wide variety of substrates, including ethanol, retinol, other aliphatic alcohols, hydroxysteroids, and lipid peroxidation products. Class I alcohol dehydrogenase, consisting of several homo- and heterodimers of alpha, beta, and gamma subunits, exhibits high activity for ethanol oxidation and plays a major role in ethanol catabolism. Three genes encoding alpha, beta and gamma subunits are tandemly organized in a genomic segment as a gene cluster. This gene is monomorphic and predominant in fetal and infant livers, whereas the genes encoding beta and gamma subunits are polymorphic and strongly expressed in adult livers. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-53144
Species: Hu, Mu, Rt, Bv, Ca, Eq, GP, Rb, Ye, Ze
Applications: WB, IHC
NB100-56603
Species: Hu, Mu, Pm
Applications: WB, IHC, IHC-P
NBP2-38530
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-02164
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-87416
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-00649
Species: Hu, Rt, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P
H00057016-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
H00000126-D01P
Species: Hu, Mu
Applications: WB
NBP1-55039
Species: Hu, Mu, Rt, Bv, Ca, Eq, GP, Rb, Ze
Applications: WB
NBP2-02192
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-29487
Species: Hu, Mu, Ha, Mk, Pm, Rb
Applications: IHC, IHC-P, ICC
NBP1-69565
Species: Hu, Mu, Rt, Po, Bv, Ca, Eq, GP, Rb, Sh
Applications: WB, IHC, IHC-P
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-90232
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-67126
Species: Hu, Fi, Ze
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-57672
Species: Hu, Rt, Bv, Ca, Eq, GP, Rb, Ye, Ze
Applications: WB

Publications for alcohol dehydrogenase 1A Antibody (NBP1-57672) (0)

There are no publications for alcohol dehydrogenase 1A Antibody (NBP1-57672).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for alcohol dehydrogenase 1A Antibody (NBP1-57672) (0)

There are no reviews for alcohol dehydrogenase 1A Antibody (NBP1-57672). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for alcohol dehydrogenase 1A Antibody (NBP1-57672) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional alcohol dehydrogenase 1A Products

Bioinformatics Tool for alcohol dehydrogenase 1A Antibody (NBP1-57672)

Discover related pathways, diseases and genes to alcohol dehydrogenase 1A Antibody (NBP1-57672). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for alcohol dehydrogenase 1A Antibody (NBP1-57672)

Discover more about diseases related to alcohol dehydrogenase 1A Antibody (NBP1-57672).
 

Pathways for alcohol dehydrogenase 1A Antibody (NBP1-57672)

View related products by pathway.

PTMs for alcohol dehydrogenase 1A Antibody (NBP1-57672)

Learn more about PTMs related to alcohol dehydrogenase 1A Antibody (NBP1-57672).

Blogs on alcohol dehydrogenase 1A

There are no specific blogs for alcohol dehydrogenase 1A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our alcohol dehydrogenase 1A Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ADH1A
Uniprot