Albumin Antibody - BSA Free

Western Blot: Albumin Antibody [NBP2-38174] - Analysis using Anti-ALB antibody NBP2-38174 (A) shows similar pattern to independent antibody NBP2-38175 (B).

Immunocytochemistry/Immunofluorescence: Albumin Antibody [NBP2-38174] - Immunofluorescent staining of human cell line Hep G2 shows localization to endoplasmic reticulum & the Golgi apparatus.

Staining of human kidney shows strong positivity in plasma.

Staining of human pancreas shows strong positivity in plasma.

Staining of human placenta shows strong positivity in plasma.

Staining of human prostate shows strong positivity in plasma.

Staining of human kidney, pancreas, placenta and prostate HPA031024 (A) shows similar protein distribution across tissues to independent antibody HPA031025 (B).

• Reactivity: Hu
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Albumin Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: ADLPSLAADFVESKDVCKNYAEAKDVFLGMFLYEYARRHPDYSVVLLLRLAKTYETTLEKCCAAADPHECYAKVFDEF
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ALB
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry-Paraffin 1:5000 - 1:10000
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  Albumin Protein (NBP2-38174PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Albumin Antibody - BSA Free

• ALB
• Albumin
• cell growth inhibiting protein 42
• DKFZp779N1935
• growth-inhibiting protein 20
• PRO0883
• PRO0903
• PRO1341
• serum albumin

Background

Albumin is a soluble, monomeric protein which comprises about one half of the blood serum protein. Albumin functions primarily as a carrier protein for steroids, fatty acids, and thyroid hormones and plays a role in stabilizing extracellular fluid volume. Mutations in this gene on chromosome 4 result in various anomalous proteins. Albumin is a globular unglycosylated serum protein of molecular weight 65,000. The human albumin gene is 16,961 nucleotides long from the putative 'cap' site to the first poly(A) addition site. It is split into 15 exons which are symmetrically placed within the 3 domains that are thought to have arisen by triplication of a single primordial domain. Albumin is synthesized in the liver as preproalbumin which has an N terminal peptide that is removed before the nascent protein is released from the rough endoplasmic reticulum. The product, proalbumin, is in turn cleaved in the Golgi vesicles to produce the secreted albumin.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ALB
• Uniprot:
  • P02768(Human)