AKT2 Antibody - Azide and BSA Free

Western Blot: AKT2 Antibody [NBP3-05341] - Western blot analysis of extracts of various cell lines, using AKT2 antibody (NBP3-05341) at 1:3000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 60s.

Western Blot: AKT2 Antibody - Azide and BSA Free [NBP3-05341] - Western blot analysis of lysates from 293T cells, using AKT2 Rabbit pAb (A18019) at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25μg per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 1s.

• Reactivity: Hu, Mu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: Azide and BSA Free

AKT2 Antibody - Azide and BSA Free Summary

• Description: Novus Biologicals Rabbit AKT2 Antibody - Azide and BSA Free (NBP3-05341) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 381-481 of human AKT2 (NP_001617.1). LAGLLKKDPKQRLGGGPSDAKEVMEHRFFLSINWQDVVQKKLLPPFKPQVTSEVDTRYFDDEFTAQSITITPPDRYDSLGLLELDQRTHFPQFSYSASIRE
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: AKT2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:1000 - 1:5000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.01% Thimerosal
• Purity: Affinity purified

Alternate Names for AKT2 Antibody - Azide and BSA Free

• Akt2
• EC 2.7.11
• EC 2.7.11.1
• Murine thymoma viral (v-akt) homolog-2
• PKB beta
• PKBB
• PKBBETA
• PRKBB
• Protein kinase Akt-2
• Protein kinase B beta
• rac protein kinase beta
• RAC-beta serine/threonine-protein kinase
• RAC-beta
• RAC-PK-beta
• v-akt murine thymoma viral oncogene homolog 2

Background

AKT2 is a putative oncogene encoding a protein belonging to a subfamily of serine/threonine kinases containing SH2-like (Src homology 2-like) domains. The gene was shown to be amplified and overexpressed in 2 of 8 ovarian carcinoma cell lines and 2 of 15 primary ovarian tumors. Overexpression contributes to the malignant phenotype of a subset of human ductal pancreatic cancers. The encoded protein is a general protein kinase capable of phophorylating several known proteins.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Bioinformatics

• Gene Symbol: AKT2