AKR1C2 Antibody

Images

 
Western Blot: AKR1C2 Antibody [H00001646-B02P] - Analysis of AKR1C2 expression in human liver.
Western Blot: AKR1C2 Antibody [H00001646-B02P] - Analysis of AKR1C2 expression in transfected 293T cell line by AKR1C2 polyclonal antibody. Lane 1: AKR1C2 transfected lysate(35.53 KDa). Lane 2: Non-transfected lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

AKR1C2 Antibody Summary

Immunogen
AKR1C2 (AAH07024.1, 1 a.a. - 323 a.a.) full-length human protein. MDSKYQCVKLNDGHFMPVLGFGTYAPAEVPKSKALEAVKLAIEAGFHHIDSAHVYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWSNSHRPELVRPALERSLKNLQLDYVDLYLIHFPVSVKPGEEVIPKDENGKILFDTVDLCATWEAMEKCKDAGLAKSIGVSNFNHRLLEMILNKPGLKYKPVCNQVECHPYFNQRKLLDFCKSKDIVLVAYSALGSHREEPWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTSEEMKAIDGLNRNVRYLTLDIFAGPPNYPFSDEY
Specificity
AKR1C2 - aldo-keto reductase family 1, member C2 (dihydrodiol dehydrogenase 2; bile acid binding protein; 3-alpha hydroxysteroid dehydrogenase, type III),
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
AKR1C2
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
Antibody reactivity against transfected lysate and tissue lysate for WB. It has been used for ELISA.
Publications
Read Publication using H00001646-B02P.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for AKR1C2 Antibody

  • aldo-keto reductase family 1 member C2
  • aldo-keto reductase family 1, member C2 (dihydrodiol dehydrogenase 2; bile acidbinding protein; 3-alpha hydroxysteroid dehydrogenase, type III)
  • BABP
  • Chlordecone reductase homolog HAKRD
  • DD
  • DD-2
  • DD2DD/BABP
  • DDH2FLJ53800
  • Dihydrodiol dehydrogenase 2
  • Dihydrodiol dehydrogenase/bile acid-binding protein
  • EC 1.1.1,3-alpha-HSD3
  • EC 1.1.1.213
  • EC 1.3.1.20
  • HAKRDAKR1C-pseudo
  • HBAB
  • MCDR2
  • pseudo-chlordecone reductase
  • Trans-1,2-dihydrobenzene-1,2-diol dehydrogenase
  • type II dihydrodiol dehydrogenase
  • Type III 3-alpha-hydroxysteroid dehydrogenase

Background

This gene encodes a member of the aldo/keto reductase superfamily, which consists of more than 40 known enzymes and proteins. These enzymes catalyze the conversion of aldehydes and ketones to their corresponding alcohols by utilizing NADH and/or NADPH as cofactors. The enzymes display overlapping but distinct substrate specificity. This enzyme binds bile acid with high affinity, and shows minimal 3-alpha-hydroxysteroid dehydrogenase activity. This gene shares high sequence identity with three other gene members and is clustered with those three genes at chromosome 10p15-p14. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF1513
Species: Mu
Applications: WB, Simple Western, Flow, IHC, IP, CyTOF-ready
AF4377
Species: Hu, Mu
Applications: WB, ICC
44110002
Species: Hu
Applications: WB, ELISA, ICC/IF
NB100-1269
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, PEP-ELISA
NBP1-30027
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
MAB6529
Species: Hu
Applications: WB, Simple Western
NB120-11012
Species: Hu, Bv(-), Ca(-), Eq(-), Gp(-), Mu(-), Po(-)
Applications: WB, ELISA, ICC/IF, IP
NBP1-31378
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-58268
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-43581
Species: Hu
Applications: WB, ICC/IF, IP
NBP1-89200
Species: Hu, Mu
Applications: WB, Simple Western, IHC, IHC-P
NBP1-19773
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-20648
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P
NBP2-20383
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
AF4090
Species: Hu
Applications: WB, IHC, IP, Neut
NBP1-77078
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00001109-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
H00001646-B02P
Species: Hu
Applications: WB

Publications for AKR1C2 Antibody (H00001646-B02P)(1)

Reviews for AKR1C2 Antibody (H00001646-B02P) (0)

There are no reviews for AKR1C2 Antibody (H00001646-B02P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for AKR1C2 Antibody (H00001646-B02P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional AKR1C2 Products

Bioinformatics Tool for AKR1C2 Antibody (H00001646-B02P)

Discover related pathways, diseases and genes to AKR1C2 Antibody (H00001646-B02P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for AKR1C2 Antibody (H00001646-B02P)

Discover more about diseases related to AKR1C2 Antibody (H00001646-B02P).
 

Pathways for AKR1C2 Antibody (H00001646-B02P)

View related products by pathway.

PTMs for AKR1C2 Antibody (H00001646-B02P)

Learn more about PTMs related to AKR1C2 Antibody (H00001646-B02P).

Blogs on AKR1C2

There are no specific blogs for AKR1C2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our AKR1C2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol AKR1C2
Entrez
Uniprot