AKR1B1 Antibody

Images

 
Western Blot: AKR1B1 Antibody [H00000231-D01P] - Analysis of AKR1B1 expression in transfected 293T cell line by AKR1B1 polyclonal antibody.Lane 1: AKR1B1 transfected lysate(35.90 KDa).Lane 2: Non-transfected lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

AKR1B1 Antibody Summary

Immunogen
AKR1B1 (NP_001619.1, 1 a.a. - 316 a.a.) full-length human protein. MASRLLLNNGAKMPILGLGTWKSPPGQVTEAVKVAIDVGYRHIDCAHVYQNENEVGVAIQEKLREQVVKREELFIVSKLWCTYHEKGLVKGACQKTLSDLKLDYLDLYLIHWPTGFKPGKEFFPLDESGNVVPSDTNILDTWAAMEELVDEGLVKAIGISNFNHLQVEMILNKPGLKYKPAVNQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKAIAAKHNKTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTLLSYNRNWRVCALLSCTSHKDYPFHEEF
Specificity
AKR1B1 - aldo-keto reductase family 1, member B1 (aldose reductase),
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
AKR1B1
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for AKR1B1 Antibody

  • ADR
  • Aldehyde reductase
  • Aldo-keto reductase family 1 member B1
  • aldo-keto reductase family 1, member B1 (aldose reductase)
  • ALDR1aldose reductase
  • ALR2
  • ARaldehyde reductase 1
  • EC 1.1.1
  • EC 1.1.1.21
  • Lii5-2 CTCL tumor antigen
  • low Km aldose reductase
  • MGC1804

Background

This gene encodes a member of the aldo/keto reductase superfamily, which consists of more than 40 known enzymes and proteins. This member catalyzes the reduction of a number of aldehydes, including the aldehyde form of glucose, and is thereby implicated in the development of diabetic complications by catalyzing the reduction of glucose to sorbitol. There are a few putative pseudogenes for this gene, and one of them has been confirmed and mapped to chromosome 3. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-02164
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
H00000126-D01P
Species: Hu, Mu
Applications: WB
NBP1-90233
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-00649
Species: Hu, Rt, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-45335
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
H00000130-M01
Species: Hu
Applications: WB, ELISA
AF5415
Species: Hu
Applications: WB, IHC, ICC
NB100-74413
Species: Hu, Mu, Rb
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-32920
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
AF4036
Species: Hu
Applications: WB, Simple Western
H00005324-M02
Species: Hu
Applications: WB, ELISA, IHC
NBP2-07799
Species: Hu
NBP2-47602
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NBP2-02126
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB300-731
Species: Hu, Mu, Rt, GP, Rb, Sh, Ye
Applications: WB, ChIP, B/N, Flow, GS, ICC/IF, IHC, IHC-P, IP

Publications for AKR1B1 Antibody (H00000231-D01P) (0)

There are no publications for AKR1B1 Antibody (H00000231-D01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for AKR1B1 Antibody (H00000231-D01P) (0)

There are no reviews for AKR1B1 Antibody (H00000231-D01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for AKR1B1 Antibody (H00000231-D01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional AKR1B1 Products

Bioinformatics Tool for AKR1B1 Antibody (H00000231-D01P)

Discover related pathways, diseases and genes to AKR1B1 Antibody (H00000231-D01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for AKR1B1 Antibody (H00000231-D01P)

Discover more about diseases related to AKR1B1 Antibody (H00000231-D01P).
 

Pathways for AKR1B1 Antibody (H00000231-D01P)

View related products by pathway.

PTMs for AKR1B1 Antibody (H00000231-D01P)

Learn more about PTMs related to AKR1B1 Antibody (H00000231-D01P).
 

Research Areas for AKR1B1 Antibody (H00000231-D01P)

Find related products by research area.

Blogs on AKR1B1

There are no specific blogs for AKR1B1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our AKR1B1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol AKR1B1
Entrez
Uniprot