AKR1B1 Antibody

Western Blot: AKR1B1 Antibody [H00000231-B01P] - Analysis of AKR1B1 expression in human kidney.

Western Blot: AKR1B1 Antibody [H00000231-B01P] - Analysis of AKR1B1 expression in transfected 293T cell line by AKR1B1 polyclonal antibody. Lane 1: AKR1B1 transfected lysate(34.76 KDa). Lane 2: Non-transfected lysate.

Product Discontinued

AKR1B1 Antibody Summary

• Description: Quality control test: Antibody reactive against mammalian transfected lysate.
• Immunogen: AKR1B1 (AAH00260, 1 a.a. - 316 a.a.) full-length human protein. MASRLLLNNGAKMPILGLGTWKSPPGQVTEAVKVAIDVGYRHIDCAHVYQNENEVGVAIQEKLREQVVKREELFIVSKLWCTYHEKGLVKGACQKTLSDLKLDYLDLYLIHWPTGFKPGKEFFPLDESGNVVPSDTNILDTWAAMEELVDEGLVKAIGISNFNHLQVEMILNKPGLKYKPAVNQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKAIAAKHNKTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTLLSYNRNWRVCALLSCTSHKDYPFHEEF
• Specificity: AKR1B1 - aldo-keto reductase family 1, member B1 (aldose reductase),
• Isotype: IgG
• Clonality: Polyclonal
• Host: Mouse
• Gene: AKR1B1
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • Western Blot
• Application Notes: Antibody reactivity against transfected lysate and tissue lysate for WB. It has been used for ELISA.

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 22966145). Please note that this antibody is reactive to Mouse and derived from the same host, Mouse. Additional Mouse on Mouse blocking steps may be required for IHC and ICC experiments. Please contact Technical Support for more information.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.4)
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for AKR1B1 Antibody

• ADR
• Aldehyde reductase
• Aldo-keto reductase family 1 member B1
• aldo-keto reductase family 1, member B1 (aldose reductase)
• ALDR1aldose reductase
• ALR2
• ARaldehyde reductase 1
• EC 1.1.1
• EC 1.1.1.21
• Lii5-2 CTCL tumor antigen
• low Km aldose reductase
• MGC1804

Background

This gene encodes a member of the aldo/keto reductase superfamily, which consists of more than 40 known enzymes and proteins. This member catalyzes the reduction of a number of aldehydes, including the aldehyde form of glucose, and is thereby implicated in the development of diabetic complications by catalyzing the reduction of glucose to sorbitol. There are a few putative pseudogenes for this gene, and one of them has been confirmed and mapped to chromosome 3. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for AKR1B1 Antibody (H00000231-B01P)(1)

Publication using H00000231-B01P

• Hernandez-Ochoa EO, Robison P, Contreras M et al. Elevated extracellular glucose and uncontrolled type 1 diabetes enhance NFAT5 signaling and disrupt the transverse tubular network in mouse skeletal muscle. Exp Biol Med (Maywood). 2012-09-01 [PMID: 22966145] (WB, Mouse)

Bioinformatics

• Gene Symbol: AKR1B1
• Entrez:
  • 231(Human)
• Uniprot:
  • AAH00260(Human)