AIP/ARA9 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: AIP/ARA9 Antibody [NBP2-55628] - Staining of human cell line A-431 shows localization to cytosol.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

AIP/ARA9 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: MTDEEKAKAVPLIHQEGNRLYREGHVKEAAAKYYDAIACLKNLQMKEQPGSPEWIQLDKQITPLLLNYCQCKLVVEEYYEVLDHCSSILNKYDDNVKAYFKRGKAHAAVWNAQEAQADFAKVLELDPALAPVVSRELQALE
Specificity
Specificity of human AIP/ARA9 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (95%), Rat (96%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
AIP
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
AIP/ARA9 Recombinant Protein Antigen (NBP2-55628PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, pH 7.2, containing 40% glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for AIP/ARA9 Antibody

  • ARA9
  • FKBP16
  • FKBP37
  • SMTPHN
  • XAP2
  • XAP-2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-33600
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-128
Species: Hu, Mu, Rt
Applications: ChIP, GS, ICC/IF, IHC, IHC-P
AF1555
Species: Hu
Applications: WB
NB100-215
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NBP2-34294
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P
NB120-2928
Species: Hu, Mu, Rt, Pm, Rb, Sh
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB100-124
Species: Hu, Mu, Rt, Bv, Ft, Pm, Sh
Applications: WB, ChIP, GS, ICC/IF, IHC, IHC-P, IP
NBP2-66296
Species: Hu
NB120-2860
Species: Hu, Mu, Rt, Ba, Bv, Ch
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, ICC, IF
NBP1-98474
Species: Hu
Applications: WB
AF1067
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, Neut
NBP2-33413
Species: Hu
Applications: WB, IHC, IHC-P
NB100-74398
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP2-57248
Species: Hu
Applications: WB, ICC/IF
H00005498-M01
Species: Hu
Applications: WB, ELISA, IHC-P, RNAi
NBP2-55628
Species: Hu, Mu, Rt
Applications: ICC/IF

Publications for AIP/ARA9 Antibody (NBP2-55628) (0)

There are no publications for AIP/ARA9 Antibody (NBP2-55628).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for AIP/ARA9 Antibody (NBP2-55628) (0)

There are no reviews for AIP/ARA9 Antibody (NBP2-55628). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for AIP/ARA9 Antibody (NBP2-55628) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for AIP/ARA9 Antibody (NBP2-55628)

Discover related pathways, diseases and genes to AIP/ARA9 Antibody (NBP2-55628). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for AIP/ARA9 Antibody (NBP2-55628)

Discover more about diseases related to AIP/ARA9 Antibody (NBP2-55628).
 

Pathways for AIP/ARA9 Antibody (NBP2-55628)

View related products by pathway.

PTMs for AIP/ARA9 Antibody (NBP2-55628)

Learn more about PTMs related to AIP/ARA9 Antibody (NBP2-55628).
 

Research Areas for AIP/ARA9 Antibody (NBP2-55628)

Find related products by research area.

Blogs on AIP/ARA9.

Aryl Hydrocarbon Signaling: AIP, AhR, ARNT, BMAL1 and more...
AH receptor-interacting protein (AIP) is a 37 kD immunophilin-like factor found in a variety of tissues with expression levels ranging from high (spleen, thymus, pituitary heart, placenta and skeletal muscle) to low (liver, kidney and lung). It mediat...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our AIP/ARA9 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol AIP