RSF1 Antibody (3E6)

Images

 
Immunocytochemistry/ Immunofluorescence: RSF1 Antibody (3E6) [H00051773-M05] - Analysis of monoclonal antibody to RSF1 on HeLa cell. Antibody concentration 10 ug/ml
Sandwich ELISA: RSF1 Antibody (3E6) [H00051773-M05] - Detection limit for recombinant GST tagged HBXAP is approximately 0.1ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF
Clone
3E6
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

RSF1 Antibody (3E6) Summary

Immunogen
HBXAP (NP_057662.3, 1343 a.a. ~ 1441 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. IESDEEEDFENVGKVGSPLDYSLVDLPSTNGQSPGKAIENLIGKPTEKSQTPKDNSTASASLASNGTSGGQEAGAPEEEEDELLRVTDLVDYVCNSEQL
Specificity
HBXAP - hepatitis B virus x associated protein
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
RSF1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Immunocytochemistry/ Immunofluorescence
  • Sandwich ELISA
  • Western Blot 1:500
Application Notes
Antibody reactive against recombinant protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Publications
Read Publications using H00051773-M05.

Reactivity Notes

Human. Other species not tested.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for RSF1 Antibody (3E6)

  • HBV pX associated protein-8
  • HBXAPp325 subunit of RSF chromatin-remodeling complex
  • hepatitis B virus x associated protein
  • Hepatitis B virus X-associated protein
  • p325
  • remodeling and spacing factor 1
  • RSF-1
  • XAP8HBV pX-associated protein 8

Background

HBXAP is involved in transcription repression, transcription coactivation when associated with hepatitis B virus X protein (HBX), and chromatin remodeling and spacing when associated with SNF2H (MIM 603375).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-55310
Species: Hu, Mu
Applications: IP, WB
NB100-128
Species: Hu, Mu, Rt
Applications: ChIP, GS, ICC/IF, IHC, IHC-P, WB
NB100-127
Species: Hu, Mu, Pm, Rt
Applications: ChIP, CHIP-SEQ, Flow, ICC/IF, IHC, IHC-P, IP, Simple Western, WB
NBP2-61879
Species: Hu, Mu
Applications: ELISA, Flow, IHC, IHC-P, WB
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NB200-106
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
NBP1-77685
Species: Hu, Mu, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
NBP3-13389
Species: Hu
Applications: IHC, IHC-P, WB
NB400-114
Species: Ch, Fe, Ha, Hu, Mu, Pl, Po, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, IP, KD, WB
H00004585-M07
Species: Hu, Mu
Applications: ELISA, IHC, IHC-P, WB
NB100-56583
Species: Hu, Rb, Rt
Applications: Flow, IHC, IHC-P, KO, WB
NBP2-29463
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
1129-ER
Species: Hu
Applications: BA
NB100-124
Species: Bv, Ma, Hu, Mu, Pm, Rt, Sh
Applications: ChIP, CHIP-SEQ, GS, IB, ICC/IF, IHC, IHC-P, IP, WB
AF6810
Species: Hu
Applications: IHC, Simple Western, WB
NBP2-32840
Species: Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP2-80913
Species: Bv(-), Hu, Mu(-), Pm, Rt(-)
Applications: IHC, IHC-P, WB

Publications for RSF1 Antibody (H00051773-M05)(2)

Reviews for RSF1 Antibody (H00051773-M05) (0)

There are no reviews for RSF1 Antibody (H00051773-M05). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for RSF1 Antibody (H00051773-M05) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RSF1 Antibody (3E6) and receive a gift card or discount.

Bioinformatics

Gene Symbol RSF1
Entrez
OMIM
Uniprot