AIBZIP Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: AIBZIP Antibody [NBP1-90205] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm, nuclear membrane & mitochondria.
Immunohistochemistry-Paraffin: AIBZIP Antibody [NBP1-90205] - Staining of human prostate shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

AIBZIP Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:ELERHNISLVAQLRQLQTLIAQTSNKAAQTSTCVLILLFSLALIILPSFSPFQSRPEAGSEDYQPHGVTSRNILTHKDVTENLETQVVESRLREPPGAKDANGSTR
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CREB3L4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
AIBZIP Protein (NBP1-90205PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for AIBZIP Antibody

  • AIbZIP
  • AIBZIPcAMP-responsive element-binding protein 4
  • Androgen-induced basic leucine zipper protein
  • ATCE1JAL
  • Attaching to CRE-like 1
  • cAMP responsive element binding protein 1
  • cAMP responsive element binding protein 3-like 4
  • CREB3
  • CREB4CREB-4
  • cyclic AMP-responsive element-binding protein 3-like protein 4
  • Cyclic AMP-responsive element-binding protein 4
  • hJALcAMP-responsive element-binding protein 3-like protein 4
  • tisp40
  • Transcript induced in spermiogenesis protein 40

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-68209
Species: Hu, Mu
Applications: WB, IP, PLA
NB100-410
Species: Hu, Mu
Applications: WB, IP
NBP1-40256
Species: Hu, Mu, Rt, Fi, Ha, Rb
Applications: WB, ChIP, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready
NBP2-16008
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-82503
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-51927
Species: Hu
NBP1-06274
Species: Hu, Mu, Rt, Ch, Dr, Sh
Applications: WB, Simple Western, Flow, ICC/IF
NBP1-69668
Species: Hu
Applications: WB
NBP2-07087
Species: Hu
AF1310
Species: Hu
Applications: WB, IHC, IP
NBP1-81760
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB100-565
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-76539
Species: Hu, Mu
Applications: WB, ELISA, ICC
H00000466-D01P
Species: Hu, Mu, Rt
Applications: WB
NBP2-21584
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
MAB363
Species: Hu
Applications: WB, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
NBP1-90205
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for AIBZIP Antibody (NBP1-90205) (0)

There are no publications for AIBZIP Antibody (NBP1-90205).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for AIBZIP Antibody (NBP1-90205) (0)

There are no reviews for AIBZIP Antibody (NBP1-90205). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for AIBZIP Antibody (NBP1-90205) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional AIBZIP Products

Bioinformatics Tool for AIBZIP Antibody (NBP1-90205)

Discover related pathways, diseases and genes to AIBZIP Antibody (NBP1-90205). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for AIBZIP Antibody (NBP1-90205)

Discover more about diseases related to AIBZIP Antibody (NBP1-90205).
 

Pathways for AIBZIP Antibody (NBP1-90205)

View related products by pathway.

PTMs for AIBZIP Antibody (NBP1-90205)

Learn more about PTMs related to AIBZIP Antibody (NBP1-90205).
 

Research Areas for AIBZIP Antibody (NBP1-90205)

Find related products by research area.

Blogs on AIBZIP

There are no specific blogs for AIBZIP, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our AIBZIP Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CREB3L4